KEGG   Ficedula albicollis (collared flycatcher): 101818796Help
Entry
101818796         CDS       T02815                                 

Definition
(RefSeq) fatty acyl-CoA hydrolase precursor, medium chain-like
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00983  Drug metabolism - other enzymes
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101818796
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101818796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180 Esterase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 101818796
NCBI-ProteinID: XP_005052807
UniProt: U3JZ58
Position
11
AA seq 571 aa AA seqDB search
MASARDAVLLAGILFVGATALVAAEQPEAETKYGRVRGYQFKVDAAERTVNVFLGLPFAK
PPVGSLRFSEPQPPEPWQGVRDATSYPPMCLQDKAQGQRFSDMITNRKDRVLLEVSEDCL
YLNVYTPVPTGKQEKLPVLVWIHGGGLVFGAASSYDGSALAAFDNVVVVAIQYRLSIAGY
FSTGDEHARGNWGYLDQVAALQWIQENIIHFGGDPGSVTIFGESAGGISVSALVLSPLAK
GLFHKAISESGTVALGLFTDNPKEDAKKIAAVSGCEKSSSAAMVECLRGKTEEELLQVTL
KMDSTTLQLCSNASPGECKQNFFFVSACVDGAFFPKSPRELLSEKSITAVPYIIGVNNCE
FGWGLPMIMKYPPFVDGLDKDVARQILEANLALIIQGPVSEIADRVYKEYIEDAESPAQV
RDGLLDAMGDLYFVISSVEVARYHRDAGNPVYFYEFQHRASSLDGLVPEFVKADHGAEIA
FVFGKPFLAGGATKEEDKLSRTIMRYWTNFAKNGNPNGEGLVHWPQYGLEEKYLGIDLEQ
KVAEKLKEHRVEFWAQLKKQIQNGRINHTDL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggcgagggacgccgtgctgctggccgggatcctcttcgtcggggccacggcg
ctggtggcggcagaacaaccagaagcagagaccaaatatgggcgagtccgagggtaccag
ttcaaagtggacgctgctgagaggactgtaaatgtctttttgggacttccttttgctaag
cctccagttggatcactgaggttttctgaaccccagccacctgagccatggcaaggtgtc
agagatgccacttcctacccaccaatgtgtctacaggacaaagcacaaggacagaggttt
tcagacatgattaccaacagaaaagacagagttcttctcgaagtatctgaggattgcctg
tacctaaatgtgtacacacccgttcctacaggaaaacaggagaagctgcctgtcttagta
tggattcatggaggtggattggtttttggagcagcttcatcatatgatggctcagcatta
gcagcctttgacaacgtggtggttgtagcaattcagtacagattaagtattgctggatat
tttagcactggtgatgagcatgcccgaggtaactggggatatttagaccaagtagcagct
cttcagtggattcaggaaaatatcatacattttggaggagatccaggatctgtcactatc
tttggagaatctgcaggaggaatcagtgttagcgctcttgtcttatctcccctggccaag
ggcttgttccacaaggccatttcagagagtggtactgtagccctgggcttgttcactgac
aatcctaaggaggatgcaaaaaaaattgctgctgtctctggctgtgaaaaatccagttca
gctgcaatggttgagtgcttgagaggaaaaacagaagaagagctactacaggtaacactg
aaaatggactcaacaacactgcagctctgcagcaatgcctcgcctggagagtgcaaacag
aatttcttttttgtcagtgcatgtgtagacggtgcattttttcccaagagtcccagggaa
ttactatctgaaaaatcaatcactgcggtcccatacataataggagtaaataactgtgaa
tttggatggggacttcctatgattatgaaataccctcccttcgtggatggtctggataaa
gatgttgcacgtcaaattttagaggccaacttagcactaataattcagggccctgtgtct
gaaattgctgacagagtgtacaaggagtacatagaggatgcagagagccctgctcaggtc
cgagatggcctcctggatgcaatgggagatctctactttgtcatctcatctgtggaagtg
gccagataccacagagatgctggcaacccagtctacttttatgaattccaacatcgagca
agttcattggacggtttggtaccagagtttgtaaaagcagatcatggagctgagattgcc
tttgtctttggaaagccattcctagctggaggtgctacaaaagaagaagataaacttagc
agaactattatgagatactggaccaactttgctaaaaatggaaatcccaacggagagggt
ttggtccattggcctcagtatggcctggaggaaaaatacctgggaatagacctggagcag
aaggtagcagagaaactgaaagaacacagagtggagttttgggcacaactcaagaaacaa
attcagaacggaaggataaaccacacagatttataa

DBGET integrated database retrieval system