KEGG   Ficedula albicollis (collared flycatcher): 101818887Help
Entry
101818887         CDS       T02815                                 

Gene name
GBE1
Definition
glucan (1,4-alpha-), branching enzyme 1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fab00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 704 aa AA seqDB search
MCGLCGQPPALLSLQRQHSLIKPVTADQSWHSERYSLFYNHLKNIEESEGGLDKFTKSYK
TFGVNQLADGGIYCKEWAPGAEAVFLAGDFNGWNPFSHPYKKLEYGKWELLIPPEDGQSP
VPHGSKLKVVIRAQNGALLYRISPWARYVVRDEDKVNYDWVHWNPPQSYIHKNPSPKRLK
SLRIYESHVGIASPEGKVASYKNFTYNVLPRIKDLGYNCVQLMAIMEHAYYASFGYQVTS
FFAASSRYGTPDDLKEMIDVAHSMGITVLLDVVHSHASKNSEDGLNQFDGTDSCFFHSGY
RGTHQLWDSRLFDYANWEVLRFLLSNLRMWIEDYRFDGFRFDGVTSMLYHHHGIGTGFSG
DYNEYFGLHVDEDALCYLMLANHMINTLHPECITIAEDVSGMPALCRPVAEGGGGFDYRL
AMAIPDKWIQIIKELKDEDWNMGNIVHTLTNRRYEEKYIAYAESHDQALVGDKTLAFHLM
DAEMYTNMSVLMPLTPVIDRGIQLHKMIRLITHALGGESYLNFMGNEFGHPEWLDFPRIG
NNESYHYARRQFNLTEDDLLRYKFLNAFDRDMNKLEERFGWLASPQAYVSEKHEANKVIA
FERAGLIFIFNFHPYQSYVDYRVGIETPGKYKILLDSDAGEYGGHQRLDHNTEYFSEEFP
HNYRPNSIMQSTSSQLPRGFPMHQLKVYIPSRVALVLHNTDIPK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtctgtgtggacagcccccagcgctcctgagcctgcagagacaacactccctg
atcaaaccagtgacggctgatcaaagctggcatagtgaaaggtattctctgttttataac
cacttgaagaacattgaggaaagtgaaggtggccttgataaatttacaaaaagttacaaa
acctttggagttaaccaacttgcggatggtggaatatactgcaaggagtgggcaccagga
gcagaagcagtgtttcttgcaggtgacttcaatggctggaatccgttttctcatccgtac
aagaagttggaatatgggaagtgggagttgctcattccacctgaagatggccagtctcct
gtgccccatggatcaaagctaaaggtggtgattcgtgctcaaaacggcgccctcctctat
cgcatttcaccctgggcgagatatgtggtccgtgatgaagacaaagtgaattatgattgg
gttcactggaatccaccacagtcatatatacacaagaatccttctccgaaaagattaaaa
agcctgagaatctatgaatctcatgtgggaattgcttccccagaagggaaagttgcttct
tataaaaacttcacatacaatgtactacctagaataaaggatcttggctataactgtgtc
cagctgatggctattatggaacatgcatactatgccagttttggttatcaggtcacaagt
ttcttcgcagcatcaagccggtacggaacccctgacgacctgaaggaaatgattgacgtt
gctcactccatgggcatcacagtcctgctcgatgtggtgcacagccacgcctcaaaaaac
tcagaagatggtctcaaccagtttgatggtacagattcttgtttcttccattctggatat
agaggcactcaccagctctgggacagcaggctctttgattatgcaaactgggaagtcctg
agattcctcctgtctaatttgaggatgtggatcgaagactatcgcttcgatggattccgg
ttcgacggcgttacgtccatgttgtatcaccaccacggcatcggcacagggttcagtgga
gattacaatgagtattttggcctacatgtggatgaagatgctttgtgttacctgatgctg
gccaatcacatgattaataccttgcacccagaatgcataaccatagcagaggatgtttct
ggaatgccagctctgtgtcggcccgtggcagagggaggaggaggttttgattatcgactt
gccatggccatcccagataagtggatacagatcattaaggagctgaaagatgaagactgg
aatatgggcaatattgtgcatacattaacaaacagacggtacgaagaaaaatacattgct
tatgcagagagtcatgaccaggcactggttggggataagacactggcctttcacctgatg
gatgcagagatgtacacaaacatgagtgtgctcatgcctctgacaccagttattgatcgt
gggatacagcttcataaaatgattcgtctcattactcatgcacttggaggagagagctat
ctgaacttcatgggtaatgaatttggacatccagaatggcttgacttccccagaataggg
aataatgagagctaccactatgccagaagacagtttaatcttactgaggatgatcttctt
cgctataaattcctaaatgcctttgatagagatatgaataaattggaggaaagatttggc
tggcttgcatctccccaggcctatgtgagtgaaaagcatgaagccaataaagtcatagca
tttgagagagcaggtcttatttttattttcaatttccatccataccaaagttatgtggac
tacagagtgggtattgaaactcctggaaagtataaaatccttctggattctgatgctgga
gaatatggagggcatcaaaggctggaccacaatacagagtacttctctgaagaatttcct
cacaattatcgacctaattcaattatgcagagtacctccagccagctccccagaggattc
cccatgcaccaattaaaggtgtacattccaagcagagtggctctggtgcttcacaacaca
gacatcccaaagtga

DBGET integrated database retrieval system