KEGG   Ficedula albicollis (collared flycatcher): 101818924Help
Entry
101818924         CDS       T02815                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:fab00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 725 aa AA seqDB search
MLGFLKEPVVVTAEINVNLVALSVMGLISRLWGLCYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSMNVPVWSLRLLPALAGALCVPLAY
QILVELHFSHCAALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQKHS
AFSGSWWFWLLLTGVACSCAVGVKYMGLFTYMLLLATAGLHFWHMIGDQNLSNISLLCHF
LARGLALIIIPMGLYLSFFYVHLALLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPVQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKLSGASLPEWGYRQLEVVGEKLSKGY
HQSMVWNVEEHRYGKSQEQKEREVELHSPTQMDISKNLSFMAKFTELQWKILTLKNEDTE
HKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVATWASANAAALVYLCLSLWYLLRRR
RKIYDIPEDAWQLWTSAGGVCAGGWAVNYLPFFLMEKTLFLYHYLPAVTFQILLIPVVLQ
HLGDHLCRSVLLKSMLSALTVAWLSSVYFVYCTFSPLSYGQPALSPTELRALRWKDTWNI
LIRKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttctgaaggagccagttgtggtcactgcagagatcaatgtgaaccttgtg
gcactgtctgtgatgggattaataagtcgtctctgggggctttgctatccacgggctgtg
gttttcgatgaagtttattatggacaattcgtttcactctacatgaagaggatcttcttt
gtggatgacagtggcccaccctttggccacatgctgctggccttgggaggttacttagga
ggatttgatggaaacttcctatggaacaggattggagctgaatacagcatgaatgttcct
gtgtggtccctgcgactcctgccagccctggctggtgctctttgtgtgcctttagcttac
cagattttggttgaactgcacttctcccactgtgctgcacttggagctgctcttctgatt
ctcttagagaactctctgatcactcaatcaaggttcatgcttctggaatcaatactgatt
ttttttatcctgcttgcagttttgtcttacctgaagttctacaatttgcaaaagcacagt
gccttctctggaagctggtggttttggctcctgctgactggagtagcctgttcttgtgca
gttggagtgaaatatatgggcctgtttacctatatgctgctcttggccactgcaggactt
cacttctggcacatgataggggaccagaacttgtcaaatatttccttgctgtgccatttt
ctagcccggggtctggccctcatcatcatccccatggggctgtacctctccttcttctac
gttcacttggctttgctgtatcgctctgggcctcatgaccagatcatgacaagtgctttc
caagccagcttggagggtgggctggctcgaatcactcagggccagcccttggaggtggcc
tatggctctcagatcacgctgcggaacgtgctgggcaagcccgtgcagtgctggctgcac
tctcacaccaacacttaccccatcaggtatgagaatggccgagggagttcccatcagcag
caggtgacctgctatcccttcaaggatgtgaacaactggtggattgtcaaagaccctgga
atgcagcagctggtggtgagtaacccaccacggcctgtcaggcacgggcacatcgtgcag
ctggtccacggcatcacaactcgctacctcaacacgcatgatgttgctgctcctcttagc
ccacactcccaagaagtttcctgctatattgattataacatctccatgccagcacagaac
ctctggagagtggaaattgtaaatcgtgagtctgacacggatgtgtggaagacaattctg
tcagaagtgaggtttgttcacgtgaacacctctgcagtgctgaagctcagtggagcatct
ctgccggagtggggataccggcagctggaggtggttggagagaagctgtccaagggctac
caccagagcatggtgtggaatgtggaagagcacagatatgggaaaagccaagagcaaaaa
gaaagggaagtggaactccactctcccacacagatggacatcagtaaaaacctcagcttc
atggcaaagttcacagaattgcagtggaaaatactcacattaaaaaatgaagacacagaa
cataagtacagctcctctgccctggactggatcacaatggacaccaatattgcctactgg
ctccaccccacctcaggggcccagatccacctcctggggaatgttgccacctgggcttca
gctaacgctgctgctctggtctacctgtgtctgtccctgtggtacttgctacggcgaagg
aggaagatttatgacatccctgaagatgcctggcagctctggacgtcagcaggaggtgtc
tgtgctggaggctgggctgtgaattacctgcccttcttcctgatggagaaaacacttttc
ctgtaccactacctgcctgctgtcacattccagattctcctgattcctgtggtactgcag
catctgggtgatcatctctgcagatctgtgctgctgaagagcatgctgagtgccctgact
gtggcctggctctcctcagtgtactttgtgtactgcaccttcagccccctgagctacggg
cagcccgcgctgtcccccacggaactcagggccctgcgctggaaggacacctggaacatc
ctgatccgaaagcagtga

DBGET integrated database retrieval system