KEGG   Ficedula albicollis (collared flycatcher): 101819015Help
Entry
101819015         CDS       T02815                                 

Gene name
KAT2A
Definition
(RefSeq) lysine acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101819015 (KAT2A)
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101819015 (KAT2A)
Transcription machinery [BR:fab03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101819015 (KAT2A)
Chromosome [BR:fab03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101819015 (KAT2A)
   HAT complexes
    PCAF complex
     101819015 (KAT2A)
    STAGA complex
     101819015 (KAT2A)
    TFTC complex
     101819015 (KAT2A)
    SAGA complex
     101819015 (KAT2A)
    SLIK complex
     101819015 (KAT2A)
    ADA-HAT complex
     101819015 (KAT2A)
    HAT-A2 complex
     101819015 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
27
AA seq 797 aa AA seqDB search
MTGPRSFLDGSRHPQSRVGALLAFGTGAAGGAGSSDPARPGLSQQQRASQRKAQVRGFPR
GKKLEKLGVFSACKANDACKCNGWKNPNPPTAPRMDLQQPVTNLSELCRSCGHALADHVS
HLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVEG
SLGSPPFEKPNIEQGVLNFVQYKFSHLPPKERQTMYELSKMFLLCLNYWKLETPSQFRQR
SQSDDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLKSIFTVTRRQLLEKFRV
EKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPAAEGAQLVSRPAAVSTI
AVPTTPLFSKKLSSSSSAASLDASTPEPLPGEKRKLPESLTLEDAKRIRVMGDIPMELVN
EVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWL
VGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCA
VTSNEQVKGYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLG
YIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGV
RQIPIESVPGIRETGWKPLGKEKGKELKDPDQLYNMLKNLLAQIKTHPSAWPFMEPVKKS
EAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSDYCKCANT
LEKFFYFKLKEGGLIDK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacctcgatcctttctggacggttcacgccacccgcagtcccgagtgggggct
ctgctcgcgttcggaactggggcggctggaggagcgggatccagcgacccggcacggccc
gggctgagccagcagcagcgggcgagccagcgcaaggcgcaggtgcgggggttcccccgc
gggaagaagctggagaagctgggggtcttctcggcttgcaaggccaatgatgcctgcaag
tgcaatggctggaagaaccccaacccccccacagcccctcgaatggacctgcagcagccg
gtgaccaacctgagtgagctgtgccgcagctgtggccatgcactggctgaccacgtgtcc
cacctggagaacgtctcggaggaagagatcaaccgtctgctgggcatggtggtggatgtg
gagaacctcttcatgtcagtgcacaaggaggaggacacggacaccaagcaggtgtatttt
tacctgttcaagctgctgcggaagtgcatcctgcagatgagccagcctgtagtcgagggg
tccctggggagccccccctttgagaaaccaaacattgagcagggagtcctgaattttgtg
cagtacaagttcagccacttgccgcccaaggagcgccagaccatgtatgagctctccaag
atgttcctgctgtgcctcaactactggaagctagagacaccgtcccagttccgtcagcgc
tcccagagtgatgatgtggccacctacaaggtcaactacaccaggtggctgtgctactgc
catgtgccacagagctgtgacagcctgccccgctatgagaccacccacgtcttcgggcgc
agcctcctcaagtccatcttcacggtgacccgccggcagctgctggagaagttccgagtg
gagaaggacaagctggtgccagagaagcggacactgatcctcactcacttccccaaattc
ctctccatgctggaggaggagatctacggtgagaactctcccatctgggaggctgatttc
acagtaccagctgcagagggtgcccagctggtgtctcgcccagctgcagtcagcaccatt
gctgtgcccaccactcctctcttcagcaagaagctcagcagcagcagctcagctgccagc
ctggatgccagcaccccagagcccctgccaggagaaaaacggaagctacctgagagcctg
acgctggaggatgccaagcggatccgtgtcatgggagacatccccatggagctggtgaac
gaggtcatgctgaccatcactgaccctgctgccatgctgggccccgagaccagcctgctg
tcggccaacgcagcgcgggacgagacggcgcggctggaggagcgccgcggcatcatcgag
ttccacgtcattggcaactcgctctcgcagaaatccaacaagaagatcctgatgtggctg
gtggggctgcagaacgtcttctcgcaccagctgccccgcatgcccaaggagtacatcact
cgcctcgtctttgacccgaagcacaagaccctggcactgatcaaggatggacgagtgatt
gggggcatctgcttccgcatgttccctacccaaggcttcacggagattgtcttctgtgct
gtcacctccaatgagcaagtgaagggctatgggacgcacctgatgaaccacctgaaggag
taccacatcaagcacagcatcctctacttccttacctatgcagatgagtacgccattggc
tacttcaaaaagcagggtttttcaaaggacatcaaggtccccaagagccgctacctggga
tacatcaaggactatgagggggcaaccctgatggagtgtgagctgaacccacgcatcccc
tacactgagctttcacacatcatcaagaagcagaaggagatcatcaagaagctgattgag
aggaagcaggcgcagatccgcaaagtctacccagggctgacgtgcttcaaggagggcgtg
cggcagatccccatcgagagcgtccctggcatccgagaaacaggatggaaaccactgggg
aaggagaaggggaaggagctgaaggacccagaccagctctacaacatgctgaagaatctc
ctggcccagatcaagacccaccccagtgcgtggcccttcatggagccagtgaagaagtca
gaggcaccagactactatgaaatcatccgcttccccattgacctgaagaccatgacggag
cggctgaagaaccgctactacgtcaccaagaagctgttcatcgccgacctgcagcgcatc
atcaccaactgccgcgagtacaacccacccgacagtgactactgcaagtgtgccaacacc
ctcgagaagttcttctacttcaagctcaaggagggggggctcattgacaagtag

DBGET integrated database retrieval system