KEGG   Ficedula albicollis (collared flycatcher): 101819015Help
Entry
101819015         CDS       T02815                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101819015 (KAT2A)
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101819015 (KAT2A)
Transcription machinery [BR:fab03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101819015 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
27
AA seq 797 aa AA seqDB search
MTGPRSFLDGSRHPQSRVGALLAFGTGAAGGAGSSDPARPGLSQQQRASQRKAQVRGFPR
GKKLEKLGVFSACKANDACKCNGWKNPNPPTAPRMDLQQPVTNLSELCRSCGHALADHVS
HLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVEG
SLGSPPFEKPNIEQGVLNFVQYKFSHLPPKERQTMYELSKMFLLCLNYWKLETPSQFRQR
SQSDDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLKSIFTVTRRQLLEKFRV
EKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPAAEGAQLVSRPAAVSTI
AVPTTPLFSKKLSSSSSAASLDASTPEPLPGEKRKLPESLTLEDAKRIRVMGDIPMELVN
EVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWL
VGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCA
VTSNEQVKGYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLG
YIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGV
RQIPIESVPGIRETGWKPLGKEKGKELKDPDQLYNMLKNLLAQIKTHPSAWPFMEPVKKS
EAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSDYCKCANT
LEKFFYFKLKEGGLIDK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacctcgatcctttctggacggttcacgccacccgcagtcccgagtgggggct
ctgctcgcgttcggaactggggcggctggaggagcgggatccagcgacccggcacggccc
gggctgagccagcagcagcgggcgagccagcgcaaggcgcaggtgcgggggttcccccgc
gggaagaagctggagaagctgggggtcttctcggcttgcaaggccaatgatgcctgcaag
tgcaatggctggaagaaccccaacccccccacagcccctcgaatggacctgcagcagccg
gtgaccaacctgagtgagctgtgccgcagctgtggccatgcactggctgaccacgtgtcc
cacctggagaacgtctcggaggaagagatcaaccgtctgctgggcatggtggtggatgtg
gagaacctcttcatgtcagtgcacaaggaggaggacacggacaccaagcaggtgtatttt
tacctgttcaagctgctgcggaagtgcatcctgcagatgagccagcctgtagtcgagggg
tccctggggagccccccctttgagaaaccaaacattgagcagggagtcctgaattttgtg
cagtacaagttcagccacttgccgcccaaggagcgccagaccatgtatgagctctccaag
atgttcctgctgtgcctcaactactggaagctagagacaccgtcccagttccgtcagcgc
tcccagagtgatgatgtggccacctacaaggtcaactacaccaggtggctgtgctactgc
catgtgccacagagctgtgacagcctgccccgctatgagaccacccacgtcttcgggcgc
agcctcctcaagtccatcttcacggtgacccgccggcagctgctggagaagttccgagtg
gagaaggacaagctggtgccagagaagcggacactgatcctcactcacttccccaaattc
ctctccatgctggaggaggagatctacggtgagaactctcccatctgggaggctgatttc
acagtaccagctgcagagggtgcccagctggtgtctcgcccagctgcagtcagcaccatt
gctgtgcccaccactcctctcttcagcaagaagctcagcagcagcagctcagctgccagc
ctggatgccagcaccccagagcccctgccaggagaaaaacggaagctacctgagagcctg
acgctggaggatgccaagcggatccgtgtcatgggagacatccccatggagctggtgaac
gaggtcatgctgaccatcactgaccctgctgccatgctgggccccgagaccagcctgctg
tcggccaacgcagcgcgggacgagacggcgcggctggaggagcgccgcggcatcatcgag
ttccacgtcattggcaactcgctctcgcagaaatccaacaagaagatcctgatgtggctg
gtggggctgcagaacgtcttctcgcaccagctgccccgcatgcccaaggagtacatcact
cgcctcgtctttgacccgaagcacaagaccctggcactgatcaaggatggacgagtgatt
gggggcatctgcttccgcatgttccctacccaaggcttcacggagattgtcttctgtgct
gtcacctccaatgagcaagtgaagggctatgggacgcacctgatgaaccacctgaaggag
taccacatcaagcacagcatcctctacttccttacctatgcagatgagtacgccattggc
tacttcaaaaagcagggtttttcaaaggacatcaaggtccccaagagccgctacctggga
tacatcaaggactatgagggggcaaccctgatggagtgtgagctgaacccacgcatcccc
tacactgagctttcacacatcatcaagaagcagaaggagatcatcaagaagctgattgag
aggaagcaggcgcagatccgcaaagtctacccagggctgacgtgcttcaaggagggcgtg
cggcagatccccatcgagagcgtccctggcatccgagaaacaggatggaaaccactgggg
aaggagaaggggaaggagctgaaggacccagaccagctctacaacatgctgaagaatctc
ctggcccagatcaagacccaccccagtgcgtggcccttcatggagccagtgaagaagtca
gaggcaccagactactatgaaatcatccgcttccccattgacctgaagaccatgacggag
cggctgaagaaccgctactacgtcaccaagaagctgttcatcgccgacctgcagcgcatc
atcaccaactgccgcgagtacaacccacccgacagtgactactgcaagtgtgccaacacc
ctcgagaagttcttctacttcaagctcaaggagggggggctcattgacaagtag

DBGET integrated database retrieval system