KEGG   Ficedula albicollis (collared flycatcher): 101820857Help
Entry
101820857         CDS       T02815                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101820857 (KAT2B)
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101820857 (KAT2B)
Transcription machinery [BR:fab03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101820857 (KAT2B)
Chromosome [BR:fab03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101820857 (KAT2B)
   HAT complexes
    PCAF complex
     101820857 (KAT2B)
    STAGA complex
     101820857 (KAT2B)
    TFTC complex
     101820857 (KAT2B)
    SAGA complex
     101820857 (KAT2B)
    SLIK complex
     101820857 (KAT2B)
    ADA-HAT complex
     101820857 (KAT2B)
    HAT-A2 complex
     101820857 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 829 aa AA seqDB search
MFGVTAREHLSAGDEESHHKKMERSVTVQRESLSGDSSNAGQRRVKGTALGQGAWSPRRT
SWSFFTAHSPFLFVMGNMDKDCCFLCFLLLINTPLLCFQAEESCKCNGWKNPNPPPTPPR
AELQQAAVSLAEPCRSCSHPLAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDAD
TKQVYFYLFKLLRKCILQMGKPVVEGSLESPPFEKPSIEQGVNNFVQYKFSHLPSKERQT
IVELAKMFLNRINYWHLETPSQRRLRSPNDDIAGYKVNYTRWLCYCNVPQFCDSLPRYET
TQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPQEKRTLILTHFPKFLSMLEEEVYSQNSP
IWDQDFMVSSSRTGQLGIQTVISPPPVARSVAYSASPSSLEQSNSGNMSPACKVSSALDP
NLGEKRKNNEPYAVEDSKRPRVVGDIPIELINEVMSTITDPAAMLGPETNFLSAHSARDE
AARLEERRGVIEFHVVGNSLNQKPNKKIMMWLVGLQNVFSHQLPRMPKEYITRLVFDPKH
KTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNIL
NFLTYADEYAIGYFKKQGFSKDIKVPRAKYVGYIKDYEGATLMGCELNPRIPYTEFSIII
KKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKERGKEAK
DPDQLYSTLKTILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYV
SKKLFMADLQRVFTNCREYNPPESEYYKCANILEKFFYTKIKEAGLIDK
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagtaacagccagggagcatctgtctgctggggatgaagagtcacatcacaag
aagatggagaggtcagtgactgtgcagagggagagtctcagtggtgacagcagcaatgct
gggcagaggagagtaaaaggcactgctctggggcagggtgcttggtccccaagaaggacc
tcctggtccttctttacagcccatagcccgttcctttttgtcatgggaaacatggacaaa
gactgctgcttcctgtgttttctgttgttgatcaatacccctttgctttgctttcaggcc
gaggagtcctgtaaatgcaatggctggaagaacccgaacccgccgcccacgccgccgcgg
gccgagctgcagcaggcagcggtcagcctggccgagccctgccgcagctgcagccacccc
ctggctgctcacgtttctcacctggagaatgtgtctgaagaagaaatgaacaggctcctg
gggattgtattggatgtggaatatctgttcacctgtgtccacaaagaagaagatgcagac
accaagcaagtttatttctacctgttcaaacttttgaggaagtgcattttacagatggga
aaacctgtagtagaaggatctttggaaagtcccccatttgagaaacctagcattgaacag
ggtgtgaataattttgtgcagtacaaatttagccacttaccctcgaaggaaaggcagaca
atagtggaactggctaaaatgtttctgaaccgcattaactactggcacctggagacacct
tctcaacggagactaagatcacccaatgatgatattgcagggtataaagtgaattatacc
aggtggctttgttattgcaatgtccctcagttttgtgacagtctacctcggtatgaaacc
acccaggtttttggtaggacattgcttcgctctgtttttactgtgatgaggcgacaactg
ctggagcaggccaggcaagaaaaagacaaacttcctcaagaaaaacgaacactaatcctc
actcattttccaaagtttttgtctatgctggaagaagaagtgtacagccagaattctccc
atttgggatcaggatttcatggtgtctagttcccgaactggccagctgggaatccagaca
gttatcagtccacctcctgttgcaagatctgttgcatacagtgcaagtccttcatctctg
gagcaatccaacagtgggaacatgagtccagcttgtaaagtttcttctgcccttgaccca
aacttaggggaaaagagaaaaaataatgaaccttatgctgtggaggattctaaaagacca
agggttgtaggggatatccctattgagttaatcaacgaagtaatgtcaacaattacagat
cctgcagcaatgcttgggccagagaccaacttcctctcggcacactcggcccgggacgag
gcagcgaggctggaggagcgcaggggggtgattgaattccatgtggtcggcaactccctg
aaccagaagcccaacaagaagatcatgatgtggctggttggtctgcagaatgtgttctcc
caccagctgcctcgaatgccgaaggaatacatcacccgcttggtctttgatccgaaacat
aaaacccttgcattaataaaagatggtcgtgttatcggtggtatctgcttccggatgttc
ccctcccaaggttttacagagattgttttctgtgctgtgacttccaatgagcaagtcaag
ggttatgggactcacctgatgaaccatctgaaggagtaccacatcaaacacaacattctc
aacttcctcacgtacgcagatgaatatgccatcggctacttcaaaaagcaaggtttctcc
aaagatattaaagtaccaagagcaaaatatgttggctacatcaaggattacgagggtgcc
acattaatgggatgtgaattaaatccaaggatcccctacacggaattttcaatcatcatc
aaaaagcaaaaagagatcattaaaaagctcatagaaaggaagcaagctcaaatacggaaa
gtttatcctggcctttcctgcttcaaagatggagtacggcagattcctatagaaagcatt
cctggaattagagagactggctggaaaccaagcggaaaagaaagaggtaaggaggccaag
gatccagatcaactttacagcacattaaaaaccatcctgcagcaagtgaagagccatcaa
agcgcttggcccttcatggaacccgtgaagagaacagaagctcctggatattatgaagtt
ataaggtttcccatggatctcaaaacaatgagtgagcggctcaagaacaggtactacgtg
tctaagaaattattcatggcagacttgcagcgagtctttacaaactgcagagagtacaac
ccccctgagagtgaatactacaaatgtgccaatatactggagaaattcttctacacaaaa
attaaagaagctggattaattgacaagtga

DBGET integrated database retrieval system