KEGG   Ficedula albicollis (collared flycatcher): 101821455Help
Entry
101821455         CDS       T02815                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:fab00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101821455 (CLOCK)
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101821455 (CLOCK)
Transcription factors [BR:fab03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101821455 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 858 aa AA seqDB search
MFFTISTHKMSSIADRNDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGNIIYVSESITPLLEHLPSDLVDQSVFNFIPEGEHSEIYKILSSHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEQPTYEYVKFIGNFKCLNHVPNSAHNGFEGTIQRS
HRPSYEEKVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEITADKSQDSGSDNHINTVSLKEA
LERFDTSPTPSASSRSSRKSSHTAVSDHSSTPTKMTVDTSTPPRQSLSGHEKTAQRRSSL
SSQSLSSQSLGQPVTQPAISQPAALQLQSGMTQPVFQFSAQLGAMQHLKDQLEQRTRMIE
ANIHRQQEELRKIQEQLQIVHGQGLQMFLQQSSSGLNFGSVQLPSGNSSTVQQLPPINMQ
GQVVQTNQTQSGMNTGHISTPHMIQQQPLQSTATQHNQQNVLSGHNQQSSLASQSQNTVS
APLYNTMVISQPTAGNVVQVPSSLPQNNNQNAAAVTTFTQDRQIRFSQGQQLVTKLVTAP
VACGAVMVPSTMFMGQVVTAYPTFAAQQQQTQTLSITQQQQQQQQQQQQQSQQDHQQQLT
TVQQPAQSQLTQHPQQFLQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHQQHQSQQQQQ
LSRHRTDKMTDPSKVQPQ
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaccataagcacccataaaatgagctccattgcagacagaaatgatggaagc
atttttgatgggctggtggaagaagatgacaaagataaagcaaaaagggtgtctagaaac
aagtccgaaaagaagcgtcgagatcagtttaatgtacttatcaaagagttgggttccatg
cttccaggtaatgctcggaagatggataaatccactgtgctgcagaagagcattgacttt
ttacggaagcacaaagaaattactgcacaatcagatgccagtgaaattcgacaggactgg
aaaccgacattccttagtaatgaagagttcacacagttaatgttagaggctcttgatggt
ttttttttagcaattatgacagatggaaatataatatatgtgtctgaaagtataactccc
ttacttgaacatttgccatctgatcttgtggatcagagtgtatttaattttatcccagag
ggggaacattcagaaatttataaaatattgtcttctcatctgctggaaagtgattccttg
acacctgaatacttaaaatcaaaaaatcagctagaattctgttgccatatgctacgagga
acaatagatccaaaagagcaacctacgtatgaatacgtaaaatttataggaaatttcaag
tgtttgaatcacgttcccaactcagcgcacaatggttttgaaggaactattcagagatca
caccggccttcatatgaagagaaagtttgctttgtagccacagttagattagctacacct
cagtttatcaaggaaatgtgcactgtggaagaacccaatgaagagttcacatctagacac
agcttagaatggaagttcctattcttggatcacagggcacctccgataataggttatctt
ccatttgaagttttgggaacatcaggctatgattattatcatgtggatgatctagataat
ctggcaaaatgtcacgagcatttaatgcaatatgggaaagggaagtcatgttactacaga
ttccttacaaagggacaacagtggatttggctgcaaactcattactatatcacgtatcac
cagtggaattccaggccagagtttattgtctgtacgcacactgttgtaagttatgcagaa
gttagagcagaaagacgacgagaacttggtattgaggaatctcttccagagataacagca
gataaaagtcaggattctgggtctgacaatcacataaacacagtgagtctcaaagaagca
ctggaaaggtttgataccagtcccacaccttctgcttcctccaggagttcaagaaaatct
tcacatactgcagtatcggatcattcatcaacaccaactaaaatgacagtggacactagc
actcctccaaggcaaagcttatcaggtcatgaaaagactgcacaaagaagatcatctctg
agcagtcagtctttaagctcacagtctcttggacaaccagtaacacagccagcaatatct
caacctgcagctctacagctccagtctggaatgacacagcctgtgtttcagttttcagct
caattaggagctatgcaacatctaaaggaccagctagagcaaagaacacgcatgatagag
gccaatattcatcggcagcaggaagagttgcgtaagattcaagagcagcttcaaattgtt
catggtcaaggactccagatgttcttgcagcagtcatcttctggactcaactttggttct
gtgcagcttccttctggaaattcttcaaccgttcagcagctcccgccaataaatatgcaa
ggtcaagttgttcagactaatcagactcaaagtgggatgaatacaggccacataagtact
ccacacatgatacagcagcagcctttgcagagtactgcaacacagcataatcaacaaaat
gtacttagtggacataatcaacagtcttctcttgccagtcagtcacagaacacagtctcg
gcacctttgtacaacactatggtgatttctcagccaacagcaggaaatgtggtgcaggtt
ccctctagtttaccacagaacaacaaccagaatgctgctgcagtaaccacttttacacag
gacagacaaatcagattttcccaaggtcagcagcttgtaacaaaacttgtcacggccccg
gtagcgtgtggagcggtaatggtaccaagtactatgtttatgggacaggtggtgacagct
tatcccacttttgctgctcaacagcagcagacacagactttgtcaataacacagcaacaa
cagcaacagcagcagcagcagcagcagcaaagtcagcaggaccatcagcagcagctcacc
acagtgcaacaaccagctcagtcacagctgacccagcacccccagcagttcctacagaca
tccaggttacttcatggaaatcagtcggctcagcttattctctctgctgctttcccacta
caacaaagcactttcactcagtcccaccaccagcagcatcagtctcagcagcagcagcag
ctgtcacgacacagaactgacaagatgactgatccttccaaagttcagccacagtag

DBGET integrated database retrieval system