KEGG   Ficedula albicollis (collared flycatcher): 101821843Help
Entry
101821843         CDS       T02815                                 

Gene name
GYS2
Definition
glycogen synthase 2 (liver)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101821843 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101821843 (GYS2)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101821843 (GYS2)
Glycosyltransferases [BR:fab01003]
 Polysaccharide
  Storage polysaccharide
   101821843 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1A
AA seq 704 aa AA seqDB search
MPLGRSLSMTSLNGLPQCEDEDLPVEDLLLFEISWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEQNVKTQVEFSEPPNPAVKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGEFWEASNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASLDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKKSPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFDLDKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGRKLYNALLRGEIPDLNKI
LDRDDISIMKRAIFSTQRHSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPEAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQNRRQRIIQRNRTERLSDLLDWK
YLGRYYMHARHLALSRTFPDKFEMERSAPPKTEGFRYPRPSSVPPSPSASQHSSPHHSEA
EDEDEEERYDEEEEAERDRQNIKSPFSIGALPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggggagatccctgtccatgacatctctgaatgggcttcctcagtgtgaggat
gaagacctgcccgtggaggatttgttgctctttgaaatttcttgggaagttaccaacaaa
gtgggaggcatttacaccgtgatccagacaaaagccaaaaccacggcagatgaatggggt
gaaaactatttcctgattggcccctattttgagcagaatgtgaagactcaggtggaattc
tctgaacctccaaaccctgcagttaagaaggcaatggacaccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactgtttgatata
ggatcagcagcttggaacctggacaagtggaaaggtgaattttgggaagccagcaacata
gggatcccttttcatgaccgagaagccaacgatgctgtgatttttggatcattaacagcc
tggtttttgaaagagctttcctgtcagtttgatgacaagcccaatataattgcccacttc
cacgagtggcaggcaggagtgggtttaatcctgtctcgatcccagaaacttcccgtcgcc
acaatttttactacccatgcaactctgcttgggagatacttgtgtgcagccagtcttgac
ttttacaacaatctggaccagtttgacattgacaaggaggctggagagaggcagatttac
catcggtactgtatggaacgggcatctgtgcattgtgcccatgtgttcaccactgtctcc
cagatcacagccacagaggcagaacacatgcttaaaaaaagccctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcgat
cttgacaagaccttgtttttcttcattgctgggagatacgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttctgctgagggttcacaagactgat
gttacagttattgtgttcttcatcatgccagcgaagaccaacaatttcaacgtggaaacc
ttgaaaggacaagcagtccgaaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaggaaactctacaatgccttgctgagaggagaaatcccagatttgaacaagatt
cttgaccgagatgacataagcattatgaaaagagccatcttttcaactcagagacactct
ctgcctccagtgaccacccacaacatgattgatgacagcaatgacccaatcctgaacacc
atccggcgcatcgggctgttcaacaaccgcaccgaccgcgtcaaggtgatcctacatcca
gagtttctttcttcaacgagccccttgctgcccttggactacgaggagtttgttagaggc
tgccaccttggtgtgttcccatcttactatgagccctggggctacactccagctgagtgt
actgtgatgggcattcccagtgtaaccacaaacctctctggattcggctgtttcatgcag
gaacatgttgctgacccagaagcttatgggatctacatcgtggacaggcggttccgctcg
ccggacgagtcgtgcaaccagctgacccagttcctgtacggcttctgccagcagaaccgg
cgccagcgcatcatccagaggaaccgcaccgagcgcctctccgacctcctggactggaag
tacctgggcaggtattacatgcatgccagacacttggccctcagcagaacattcccagat
aaatttgagatggaacgaagtgctccaccaaagacggaagggttcaggtaccccaggcct
tcctcagtgccgccgtcgccctctgcctcccagcattccagcccccaccacagcgaggcc
gaggacgaagacgaggaggagaggtacgacgaggaggaggaggctgaaagggacaggcag
aacatcaagtcccccttttccattggagccttgccacaggggaagaagaagcagcacgga
gaatacaggaactga

DBGET integrated database retrieval system