KEGG   Ficedula albicollis (collared flycatcher): 101821887Help
Entry
101821887         CDS       T02815                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fab00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:fab00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:fab04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25
AA seq 524 aa AA seqDB search
MGPGCASVLGWLLLAQAALQATGGRPCDAKDFGHGSLVCACSATYCDTLDPLVLPAPGSY
VKYESSKAGKRLERSEGSFQHNTESPDFHLTLDTAQRYQKVKGFGGSITDAAAINIQSLS
KDAQNHLLRSYFSEEGIEYNLVRVPMASTDFSIRLYTYADAEGDFELRHFNLTEEDTRMK
IPILQAAQAVAKRPLSLYASPWTSPVWMKTNGAMTGRGTLKGSPGDKYHRAWAKYFIRFL
DEYAKHNLTFWAVTAGNEPTAGEIVFYPFQCLGFSPEHQRDFIAQDLGPALANSSHRHVQ
LIILDDQRVMLPYWAEVVLKDPVAASYISGIGIHWYLDFLAPIDLTLSITHHLFPDYFLL
STEASTGSYFWEPRVVLGGWDRGSKYSHSILTNLNNYVTGWTDWNLALDMEGGPNWSKNY
VDSPVIVDSSKDIFYKQPMFYHLGHFSKFIPEGSQRVGLAVSKRCRRCDLEHSAFLRPDG
AVVLVVLNRSPVDVSFGVSDPRVGFIEAVAPSDSIQTFLWRQPA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggggccaggctgtgccagtgtcctgggctggctcctgctggcacaggcagccctgcag
gccacaggtggccgtccctgtgatgccaaggattttgggcacggctcgctggtgtgtgcc
tgcagtgccacgtactgcgacacgctggaccccctggtcctgccagcccccggctcctac
gtcaagtacgagagcagcaaggctggcaagaggctggagaggagcgaggggagcttccag
cacaacaccgagagcccagatttccacctcaccctggacacggcacagaggtaccagaag
gtgaaagggtttggtggctccatcactgatgcagctgccatcaacatccagtccctgtcc
aaggatgcccagaaccacctgctgcgctcctacttctccgaggaaggcattgagtacaac
ctggtgcgtgtgcccatggccagcactgacttctccatccgcctgtacacctacgccgac
gccgagggcgacttcgagctgaggcacttcaacctgacagaggaggacacacgcatgaag
atccccatcctgcaagcagcccaggcagtggccaagcggccgctgtcgctgtacgccagc
ccctggacctccccagtctggatgaagacaaatggagcgatgacaggcaggggaacactg
aagggcagccctggggacaagtaccaccgggcctgggccaagtacttcatccggtttctg
gatgaatacgccaagcacaacctgaccttctgggcagtgacagcagggaacgagcccaca
gctggtgagatcgtcttctaccccttccagtgcctgggcttctcccctgagcaccagcgg
gatttcatcgcccaggacctgggcccggcgctggccaacagctcccaccgccacgtccag
ctcatcatcctggatgaccagagggtgatgctgccctactgggctgaggtggttctcaaa
gaccctgtggctgccagctacatcagcggcatcggcatccactggtacctggattttctg
gcgcccatcgacctgacactgtccatcacccatcacctcttcccggattatttcctcctc
tccacggaggcttccacaggctcctacttctgggagcccagggtggtgctgggtggctgg
gaccgtgggagcaagtacagccacagcatcctgacgaacctcaacaactacgtgacaggc
tggactgactggaacctggccctggacatggaggggggccccaactggagcaagaactac
gtggacagcccggtcatcgtggacagcagcaaggacatcttctacaagcagcccatgttc
taccacctgggccacttcagcaagttcatccccgagggctcgcagcgcgtgggactggcc
gtctccaagaggtgccgccgctgcgacctggagcactcggctttcctgcgccccgacggc
gccgtcgtcctggtggtcctgaaccgctcccccgtggacgtgtcctttggggtctctgac
ccacgtgtcggcttcatcgaggccgtggctcccagtgactccatccagacgttcctctgg
aggcagccagcctag

DBGET integrated database retrieval system