KEGG   Ficedula albicollis (collared flycatcher): 101821887Help
Entry
101821887         CDS       T02815                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101821887
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101821887
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101821887
Enzymes [BR:fab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101821887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25
AA seq 524 aa AA seqDB search
MGPGCASVLGWLLLAQAALQATGGRPCDAKDFGHGSLVCACSATYCDTLDPLVLPAPGSY
VKYESSKAGKRLERSEGSFQHNTESPDFHLTLDTAQRYQKVKGFGGSITDAAAINIQSLS
KDAQNHLLRSYFSEEGIEYNLVRVPMASTDFSIRLYTYADAEGDFELRHFNLTEEDTRMK
IPILQAAQAVAKRPLSLYASPWTSPVWMKTNGAMTGRGTLKGSPGDKYHRAWAKYFIRFL
DEYAKHNLTFWAVTAGNEPTAGEIVFYPFQCLGFSPEHQRDFIAQDLGPALANSSHRHVQ
LIILDDQRVMLPYWAEVVLKDPVAASYISGIGIHWYLDFLAPIDLTLSITHHLFPDYFLL
STEASTGSYFWEPRVVLGGWDRGSKYSHSILTNLNNYVTGWTDWNLALDMEGGPNWSKNY
VDSPVIVDSSKDIFYKQPMFYHLGHFSKFIPEGSQRVGLAVSKRCRRCDLEHSAFLRPDG
AVVLVVLNRSPVDVSFGVSDPRVGFIEAVAPSDSIQTFLWRQPA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggggccaggctgtgccagtgtcctgggctggctcctgctggcacaggcagccctgcag
gccacaggtggccgtccctgtgatgccaaggattttgggcacggctcgctggtgtgtgcc
tgcagtgccacgtactgcgacacgctggaccccctggtcctgccagcccccggctcctac
gtcaagtacgagagcagcaaggctggcaagaggctggagaggagcgaggggagcttccag
cacaacaccgagagcccagatttccacctcaccctggacacggcacagaggtaccagaag
gtgaaagggtttggtggctccatcactgatgcagctgccatcaacatccagtccctgtcc
aaggatgcccagaaccacctgctgcgctcctacttctccgaggaaggcattgagtacaac
ctggtgcgtgtgcccatggccagcactgacttctccatccgcctgtacacctacgccgac
gccgagggcgacttcgagctgaggcacttcaacctgacagaggaggacacacgcatgaag
atccccatcctgcaagcagcccaggcagtggccaagcggccgctgtcgctgtacgccagc
ccctggacctccccagtctggatgaagacaaatggagcgatgacaggcaggggaacactg
aagggcagccctggggacaagtaccaccgggcctgggccaagtacttcatccggtttctg
gatgaatacgccaagcacaacctgaccttctgggcagtgacagcagggaacgagcccaca
gctggtgagatcgtcttctaccccttccagtgcctgggcttctcccctgagcaccagcgg
gatttcatcgcccaggacctgggcccggcgctggccaacagctcccaccgccacgtccag
ctcatcatcctggatgaccagagggtgatgctgccctactgggctgaggtggttctcaaa
gaccctgtggctgccagctacatcagcggcatcggcatccactggtacctggattttctg
gcgcccatcgacctgacactgtccatcacccatcacctcttcccggattatttcctcctc
tccacggaggcttccacaggctcctacttctgggagcccagggtggtgctgggtggctgg
gaccgtgggagcaagtacagccacagcatcctgacgaacctcaacaactacgtgacaggc
tggactgactggaacctggccctggacatggaggggggccccaactggagcaagaactac
gtggacagcccggtcatcgtggacagcagcaaggacatcttctacaagcagcccatgttc
taccacctgggccacttcagcaagttcatccccgagggctcgcagcgcgtgggactggcc
gtctccaagaggtgccgccgctgcgacctggagcactcggctttcctgcgccccgacggc
gccgtcgtcctggtggtcctgaaccgctcccccgtggacgtgtcctttggggtctctgac
ccacgtgtcggcttcatcgaggccgtggctcccagtgactccatccagacgttcctctgg
aggcagccagcctag

DBGET integrated database retrieval system