KEGG   Ficedula albicollis (collared flycatcher): 101821950Help
Entry
101821950         CDS       T02815                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     101821950
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101821950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26
AA seq 150 aa AA seqDB search
MRKSMLFLGFLLAFLGLALPGTQGKIISRCEMVKILRRNGFQGFEGTTVADWMCLVKHES
DYNTRAYNNNGPSRDYGIFQINSKYWCNDGRTAGATNGCHISCSKLQDDNIEDDIRCAKK
IAREAHGLSPWYGWKNHCRGRNLSSYVRGC
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtcaatgctcttccttggctttcttcttgctttccttggcctggctctgcca
ggcacccagggaaaaataatttccagatgtgagatggtgaagatcctacgtcggaatggc
tttcagggctttgagggcacaactgttgctgactggatgtgcctggtgaaacatgagagt
gattataacacaagagcgtacaataacaacggtccaagcagggactatggcatctttcag
atcaacagcaagtattggtgcaatgatggcaggactgctggagccacgaatggctgccac
atcagctgctcaaaactgcaagatgataatattgaggatgatattcggtgtgccaagaag
attgctcgggaggctcatggcctcagtccctggtatggctggaaaaaccactgccggggc
agaaacctgagttcctatgtcagaggttgctaa

DBGET integrated database retrieval system