KEGG   Ficedula albicollis (collared flycatcher): 101821997Help
Entry
101821997         CDS       T02815                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
fab  Ficedula albicollis (collared flycatcher)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 727 aa AA seqDB search
MEKQISFLLSSARSNLLVLFFSGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLF
KWIEERRSRRKVSTLVDETSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCNNVDLGP
TLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHF
VSYVPIKGRLFELDGLKVYPIDHGPWADDEEWTDKARRVIMERIGLATAGEPYHDIRFNL
MAVVPDRRMKYESKLHILKMNRQTVLEALQQLIRVTQPELIQTQKSQESQPAEEAKPASS
KTVTPESTHADGTDEPTSQGHPTATQSPPSKSKPVPKATASGINGAPPANPNPIVQRLPA
FLDNHNYAKSPMQEEEDLAAGVGRNRVPVRQHQQYSDDEDDYDDDDEEEVRNTNSAIRYK
RKGQVKQEHVAGAADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSGGGAAVAVVTH
SQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEEDGLLRV
DCMRYNRAVRDLGPIVSSGLLHLTEDGVFCPLAAVDGKNSPSSIKPSEEVPVAIKLEEKE
GSEASDSKEKVGLGRTSDHPGGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKI
DDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSR
PYKAKRQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacagatttcctttctgctctcttcagccagaagtaacctgttggttttgttc
ttttcaggccttttcacactcctggttgaagattttggggtcaagggagtgcaggttgag
gagatttatgatctgcagagcaaatgccaaggccccgtgtatgggttcatcttcctgttc
aagtggattgaggagcgccggtcccgccgcaaggtctccacgctggtggatgagacgtcg
gtgatcgatgatgacatcgtcaataacatgttctttgctcaccagctgatccccaattcc
tgtgccacccatgccctgctgagtgtcctcctgaactgcaacaatgttgacctgggtccc
acattgagccgcatgaaggatttcaccaaaggctttagccctgagagcaaaggctatgcc
atcggcaacgccccggagctggccaaggcccacaacagccatgccaggccagagccacgg
cacctgccagagaagcagaacggcatcagcgcagtgcggaccatggaggcttttcacttt
gtcagctatgtccccatcaagggacgactctttgagctggatggcctgaaggtctatccc
attgaccacgggccatgggcagatgacgaggaatggacagacaaagccaggagagtgatc
atggagcgcattggcctggccactgcaggggagccataccacgacatccgcttcaacctg
atggccgtggtgcccgaccggaggatgaagtacgagtccaaactgcacatactgaagatg
aaccgccagactgtgctggaggccttgcagcagcttatccgagtgactcagcctgagctg
atccagacccagaagtctcaggagtctcagcctgctgaagaggcaaagccagccagcagc
aagaccgtgactccagagagcactcatgcagatggcactgatgaacccaccagccagggc
caccccacagccacgcagagcccacccagcaaatccaaaccagtgccaaaggcaacagca
agcggcatcaacggggcccctccagcaaaccccaaccccattgtgcagagactgccagcc
ttcctggataaccacaactatgccaagtcccccatgcaggaagaggaagaccttgcagca
ggagtaggtcgcaaccgggtcccagtccgacagcaccagcagtactcggatgatgaggat
gactatgatgatgatgatgaggaggaagttcgtaacaccaactcagccatcaggtacaag
aggaaagggcaagtgaagcaagagcacgtggcaggggccgcagatggccagctctctgtc
ctgcagcccaacaccatcaatgtcctggctgagaagctgaaggaatctcagaaggatctt
tccattcccctgtccatcaagacgagcggcgggggagccgccgtggcagtggtcacccac
tcgcagccctcccccacgcccagcaacgagagcaccgacaccgcctccgagatcggcagc
gccttcaactccccgctgcgctcccccatccgctcggccaaccccacgcgcccctccagc
cccgtcacctcccacatctccaaggtgctcttcggggaggaggacgggctgctgcgcgtc
gactgcatgcgctacaaccgggccgtcagggacctggggcccattgtcagctccggcctg
ctgcacctcaccgaggacggcgtcttctgcccgctggctgctgtagatgggaaaaactcc
ccctcttccatcaaacccagtgaagaggtcccggttgcgatcaaactggaggagaaggag
ggcagtgaggccagtgacagcaaagagaaggtgggacttggcaggaccagtgatcaccct
gggggggaaaagtattctcccaaggagctgctggcgctgctcaagtgtgtggaagcagag
attgcaaactacgaggcctgcctgaaggaggaggtagagaagaggaagaaattcaagatt
gatgaccagaggagaacccacaactacgacgagttcatctgtactttcatatccatgctg
gcccaggaaggcatgctggccagcctggtggagcagaacatctcggtgcgcaggcggcag
ggagtcagcatcggccgcctgcacaagcagaggaagccggaccgccggaaacgctcccgc
ccctacaaagccaagcgccagtag

DBGET integrated database retrieval system