KEGG   Ferroplasma acidarmanus: FACI_IFERC01G0255Help
Entry
FACI_IFERC01G0255 CDS       T02713                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
fac  Ferroplasma acidarmanus
Brite
Enzymes [BR:fac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     FACI_IFERC01G0255
Transfer RNA biogenesis [BR:fac03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    FACI_IFERC01G0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297614..299161
Genome map
AA seq 515 aa AA seqDB search
MDFYDQITSLIVNGKIKDKDQLQREKLLLSKKFNLDVVPSDVEILNYGDNRRFVQLLRKK
PTRTVSGVAVVAAMTSPEACPHGKCIFCPGGIDSNSPQSYTGYEPSALRGRTNYYDSYNI
AFSRLKQLETIGHDTSKVDLIVMGGTFTARSREYQEEFVKGCIDGMNRKISPTLDQAILE
NEFSQRRCVGMTIETKPDWFNEREIDEALSYGTTKVELGIQVLNDRILRLNRRGHGVEEI
VRSTQLARDAGLKVLYHLMPGMYGSSYKEDIKSFDMVMGDERFRPDMLKIYPTLVVKNTA
LYKYWKEGKYIPYDTEKVVRMVTYFMKNMPPWVRVMRMQRDIPVNFIEAGVKRSDLHNLV
DLEMEEMGIKTMEIRSREVGIMKDSFGNDYTLTRRNYRASGGDEIFLSFESSNGDIIGYL
RLRIPSEMAHRKEVLSSSVIREIKVMGNIVPIGEESGENWQHHGFGKKLLDEAERISLEE
YGKKRIIVISGIGVRNYFRKYGYERLGPYMAKEIS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggatttttatgatcagataacttctctaatagttaacgggaaaattaaggataaggat
cagcttcagagagagaaactcttattatcaaaaaaattcaatctcgacgttgttcccagt
gatgtagaaattcttaattatggagataatagaagatttgtgcagttgctgaggaagaaa
cctaccaggactgtgtcaggagttgcggttgtggcggctatgacatcccctgaagcttgc
ccccacggcaaatgtattttctgccctggtggaattgacagcaattctccccaatcatat
acagggtatgagccatctgccctcaggggaaggacaaattattatgattcttataatatt
gcattcagcaggctaaaacagctggaaacaataggccatgataccagtaaagttgattta
atagtcatgggtggtacatttaccgccagatccagagaataccaggaagaatttgttaaa
ggatgcattgatggaatgaacaggaaaatatcccctacgctggaccaggcaatactggaa
aatgaattttcacagaggcgctgtgttggcatgactattgaaacaaagcctgactggttc
aacgagagggaaatagatgaggcgttatcctacgggacaactaaggttgagcttggcatt
caggtacttaatgacaggatactcaggcttaacagaagagggcatggcgtggaagaaata
gtgaggtcaacccagctcgcaagggatgcgggattgaaggttttatatcaccttatgcca
ggaatgtacgggtcgtcctataaagaggatataaaaagctttgatatggttatgggtgat
gagaggttcaggccagatatgctaaagatatatccaacgctcgttgtaaaaaatacagca
ttgtataagtactggaaagaaggaaaatacataccatacgatactgaaaaggtagtcagg
atggttacctattttatgaaaaacatgccaccatgggtaagggtaatgaggatgcagagg
gatatacctgttaattttattgaggcaggggtaaagaggagtgacctgcataaccttgtt
gacctggaaatggaggaaatgggaataaaaactatggaaattagaagccgggaagttgga
ataatgaaagattcctttggaaatgattataccctcacaagaaggaattacagggcatcc
ggcggtgatgaaatattcctttcctttgagagttcgaatggtgatattattggatacctc
aggcttagaattccatcagaaatggcacatcgcaaggaagttctatcctcatcagtgata
agggaaataaaggttatgggaaatatagtaccgataggtgaagagtccggagaaaactgg
cagcaccatggattcgggaaaaaactgctggatgaagccgaaaggatatcacttgaggaa
tatggtaaaaagcgtataattgtaatcagtggaataggagttagaaactatttcaggaaa
tatggatatgaaaggctgggtccctatatggccaaggaaatttcttaa

DBGET integrated database retrieval system