KEGG   Ferroplasma acidarmanus: FACI_IFERC01G1041Help
Entry
FACI_IFERC01G1041 CDS       T02713                                 

Definition
thymidine kinase related protein
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
fac  Ferroplasma acidarmanus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fac00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1020789..1021439
Genome map
AA seq 216 aa AA seqDB search
MLVKNLYELIILTIMKNIIIGKLTVITGPMFSGKTSRLIELLEREILAGRNTLLFKPEMD
KRYDTTFVTTHKGMRLPAIVLNTDNEGVEKMYNLSKNVDVIGIDEAQFWNHGSILPEIAD
KIASENKIVYAAALNKNHLGNPFKTSMDIISRADQVYSLTAVCAKCGEDATFSQRILNGK
EIFGEQIKIGGMESYEPRCRKCFVYPDVSEVQRLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctggttaaaaacttatatgagttaataatactaacaataatgaaaaatatcattata
ggaaaactaacagttatcaccggtcctatgttttcaggcaaaacttcaagattaattgaa
ctgttagaacgggaaattctggcagggcgaaatactttattatttaagccagaaatggac
aaaagatatgatacaacatttgtgaccacccataagggcatgaggcttccagcaatagtg
ttaaatacagataatgagggcgtggagaaaatgtataacctgtctaaaaatgtggatgtg
ataggcatagacgaagcccagttctggaatcacgggtccatattgcctgagatagcagat
aaaattgccagtgaaaataaaattgtttatgcagccgccctgaacaaaaaccatcttgga
aacccttttaaaacttctatggatattatatcaagggcagatcaggtttattcattgacc
gcagtatgtgcaaaatgcggtgaagatgcgacattttctcagagaattttgaatggcaaa
gaaatattcggcgagcagataaaaataggcggcatggagagttatgaaccgcgatgcaga
aaatgttttgtttaccctgatgtatctgaagttcaaaggcttgaagagtaa

DBGET integrated database retrieval system