KEGG   Ferroplasma acidarmanus: FACI_IFERC01G1041Help
Entry
FACI_IFERC01G1041 CDS       T02713                                 

Definition
thymidine kinase related protein
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
fac  Ferroplasma acidarmanus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fac00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FACI_IFERC01G1041
Enzymes [BR:fac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FACI_IFERC01G1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1020789..1021439
Genome map
AA seq 216 aa AA seqDB search
MLVKNLYELIILTIMKNIIIGKLTVITGPMFSGKTSRLIELLEREILAGRNTLLFKPEMD
KRYDTTFVTTHKGMRLPAIVLNTDNEGVEKMYNLSKNVDVIGIDEAQFWNHGSILPEIAD
KIASENKIVYAAALNKNHLGNPFKTSMDIISRADQVYSLTAVCAKCGEDATFSQRILNGK
EIFGEQIKIGGMESYEPRCRKCFVYPDVSEVQRLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctggttaaaaacttatatgagttaataatactaacaataatgaaaaatatcattata
ggaaaactaacagttatcaccggtcctatgttttcaggcaaaacttcaagattaattgaa
ctgttagaacgggaaattctggcagggcgaaatactttattatttaagccagaaatggac
aaaagatatgatacaacatttgtgaccacccataagggcatgaggcttccagcaatagtg
ttaaatacagataatgagggcgtggagaaaatgtataacctgtctaaaaatgtggatgtg
ataggcatagacgaagcccagttctggaatcacgggtccatattgcctgagatagcagat
aaaattgccagtgaaaataaaattgtttatgcagccgccctgaacaaaaaccatcttgga
aacccttttaaaacttctatggatattatatcaagggcagatcaggtttattcattgacc
gcagtatgtgcaaaatgcggtgaagatgcgacattttctcagagaattttgaatggcaaa
gaaatattcggcgagcagataaaaataggcggcatggagagttatgaaccgcgatgcaga
aaatgttttgtttaccctgatgtatctgaagttcaaaggcttgaagagtaa

DBGET integrated database retrieval system