KEGG   Ferroplasma acidarmanus: FACI_IFERC01G1453Help
Entry
FACI_IFERC01G1453 CDS       T02713                                 

Definition
hypothetical protein
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
fac  Ferroplasma acidarmanus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:fac00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fac00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fac00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1417442..1418692
Genome map
AA seq 416 aa AA seqDB search
MENLDPFDIALEQLNKAAKVMKLDKASIDVLSSPREILQVSIPVKMDNGTTEVFTGFRVH
YNNARGPMKGGIRYYIKENLSEVKALSAWMTWKTALLGLPFGGAKGGIICDPKKMSKMEL
ERLSRGYIDAIANFIGPEIDVPAPDVYTTPQIMGWMMDEYEKIVRHSAPGVITGKPLTIG
GSLGRGDATAKGGMYVLREGAKYKGIDLTKAKFAVQGFGNAGQFAVKFVKEMFGAKVVAV
SDSSGGIYKESGIDYAELLAHKEKHGSVENFPGSKNISNEELLESDVDVLIPSAIEDQLT
GANASKVKAKIVLELANGPSTPEADEIFYKNNVLLLPDFLSNAGGVTVSYFEWVQNITGD
YWTEDVVYSKLDEKMTFATKDVLATHEKYQTDPRTAAYIIAIQRVLDAMKARGLLN
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttagatccgtttgatattgcgctggaacagcttaacaaggctgctaaagtt
atgaagcttgataaggcaagcatcgatgttttgagttctcccagggagatccttcaggtg
agcatacctgtgaagatggataatggaacaactgaagtttttaccgggttcagggtacat
tataataatgccagggggcctatgaaaggaggaatcagatattatattaaagaaaacctt
tctgaagtaaaggctctatcagcatggatgacatggaaaacagcacttctcgggcttcca
ttcggtggtgcaaagggtggtataatatgcgacccgaagaaaatgagcaagatggaactg
gaaagattgagcagagggtatatcgatgccatagcaaacttcatcggccctgaaatagat
gttccggctccagatgtttatacaacaccccagataatgggctggatgatggatgagtac
gaaaaaatagtcaggcattcagctccaggagttatcacaggaaaaccattgacaataggc
gggtctcttggaagaggagatgccacagccaaaggtggaatgtatgtattaagagaaggt
gcaaaatacaagggcatagaccttacaaaggcaaaatttgccgtgcagggtttcggaaat
gcaggccagtttgctgttaaattcgtaaaggaaatgtttggcgcaaaggttgttgcagtt
tctgactcaagtggcggaatttacaaggaaagtggcatagactatgcagaacttcttgca
cataaagaaaaacacggatcagtagaaaacttccccgggtcaaagaacatatcaaatgaa
gaattattagaatctgatgttgatgtattgataccctcagcaatagaagaccagctaacc
ggcgcgaatgcatcgaaagtaaaggcaaaaatcgtgctggaacttgcaaatgggccatca
acaccggaagctgatgaaatattctacaaaaacaatgtgttgctgttacctgatttccta
tccaatgcaggtggtgtcacagtatcatatttcgaatgggttcagaatataaccggagac
tactggacagaggatgttgtatacagcaagctggatgagaagatgacatttgcaacaaaa
gatgtactggcaacccatgaaaaataccagactgaccccaggacagctgcatatataata
gccatacagagagtactcgacgctatgaaagccagaggactcttaaactaa

DBGET integrated database retrieval system