KEGG   Fibrella aestuarina: FAES_0471Help
Entry
FAES_0471         CDS       T02429                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fae  Fibrella aestuarina
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FAES_0471 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FAES_0471 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FAES_0471 (thrC)
Enzymes [BR:fae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FAES_0471 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(603483..604847)
Genome map
AA seq 454 aa AA seqDB search
MVCCNRLFARNLRALLPDYAMTFYSTNDATNVVSVQEALFNSMPQDRGLYMPSAIPALPA
GYLNSLPGKSFADIAYDLTKLWLTGDLTDAQVAQLVEQAFPFDTPLVELEAGRKYVLELF
HGPSLAFKDVGARFMAGLMSIFSASYDKEVHILVATSGDTGGAVAMGFHNVPGVRVSILY
PKGRVSLLQEKQLTTLGGNVQAFEVDGSFDDCQALVKTAFLDQELNQTFALSSANSINIF
RLIPQSFYYFRALAQLAPNHKPVVFSTPSGNFGNLSAGVLGWRMGLPVEAFVAATNLNKV
VPDYLSSGTYEPMASLATLSNAMDVGNPSNFSRLKRLLGDDYASITDRIKGYYFTDDQTI
DEIKRLRDVYNYVACPHTAVGLLGLESYQHFAVDNCGIALATAHPAKFSPAVDEILGQAV
DVPERLAILANRTKQAIAIPGTFEAFKESLLQTA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggtatgctgtaaccgactgtttgcacgtaacttgcgtgctcttttgcccgattacgct
atgactttctacagtactaatgacgcaacaaatgttgtttcggttcaggaggcattgttt
aacagtatgccccaggatcgtggattatacatgccctcggcaattccggcgttaccggct
ggctatctgaattcgctgcccggtaaatcgtttgctgacattgcctacgacctgaccaag
ctctggctaaccggcgatctgaccgacgcacaagtagcccaattagtcgagcaggccttc
ccgttcgacacgcccctcgttgagctggaagcgggccggaaatacgtgcttgaactcttt
cacggtccttcgctggctttcaaagatgtgggcgctcgttttatggctggcttgatgtcg
atcttttcggcgtcgtatgataaggaggttcatatcctggtggcgacctctggtgatacg
ggcggagctgtcgcgatgggtttccacaacgtacctggcgtgcgggtttccattctctat
ccgaaaggacgggtcagcttgttgcaggaaaagcagctgacgacgttgggcggcaatgtg
caggcctttgaggtcgatggttcgttcgacgattgtcaggcgttggtcaagacggcattt
ctggatcaagaactgaaccagacttttgccttgtcgtcggctaattcaattaacatcttc
cggcttattccgcaaagcttctattatttccgcgccttggctcaactggcacctaaccac
aagccggttgttttctccacgccttcgggcaacttcggtaaccttagcgccggggttctc
ggctggcgaatgggactacccgttgaggcctttgtggcagcgaccaatttgaacaaagtt
gtgcctgattatctgtcgtcaggtacgtacgaaccaatggcttcactggctacgctctcc
aacgcgatggatgtaggtaacccaagcaatttcagccggctaaaacggttgctgggggat
gattatgcttcaattaccgatcgcataaaaggctactatttcactgacgatcagactatt
gatgagataaaaaggcttcgcgatgtgtataactacgttgcttgtccccatacggctgtt
ggtttattgggccttgaaagttatcaacattttgctgtggataactgtggaattgcgttg
gcaactgctcatccagccaaatttagcccggcggttgacgagattttgggacaagctgtc
gacgtacctgagcggcttgctatactggccaatcgcaccaaacaagcgattgccattcca
ggtacgttcgaggcgtttaaagaatcacttctccaaacggcataa

DBGET integrated database retrieval system