KEGG   Fibrella aestuarina: FAES_0482Help
Entry
FAES_0482         CDS       T02429                                 

Definition
Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fae  Fibrella aestuarina
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fae01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fae00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(622378..623205)
Genome map
AA seq 275 aa AA seqDB search
MTILDTIIARKREEVAHRKAAVSEAELRQAPLFGRAVNSARAALLAPGSSGVIAEYKRKS
PSKGVINDRHSVTETTAGYVASGAAVLSVLTDEPFFGGTPADLQAARASNPTTPILRKDF
VIDGYQLLEAKAWGADLVLLIAACLSPAEVRSLSQQAQELGLEVLLEVHDADELQRSLCE
TVDLVGVNNRNLKTFVTSIDTSLQLADQIPDQFVKVTESGLQDAATMVKLYTAGYRAFLI
GEAFMKTNDPAAALTSLLADYQQQRTTCTQSSLTV
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccattctcgatacgattattgcccgcaaacgggaagaagttgcccaccgtaaggcc
gccgtttcagaagcagaattacgtcaggcaccgctgttcgggcgggcggtcaattcggca
cgggcggcgctgctggccccgggctcgtcgggcgtgattgccgagtacaagcggaagtca
ccttccaagggggtcatcaacgatcggcattcggtcaccgaaacaacggctgggtacgtt
gcgtcgggtgcagccgtactgtcggtgctgaccgacgaaccgttttttgggggtacgccg
gccgatttgcaggcggcacgggcaagcaacccaaccacccccattctacgtaaagacttc
gtaatagacggctatcagttgctggaggcgaaagcctggggtgccgacctggtgctgctc
atcgcggcctgcctgtcgcccgccgaggtacgttcgttgagtcagcaggcgcaagagcta
ggcctggaggttttgctggaagtacacgatgctgacgaattacaacgttctttatgcgaa
accgttgatctggtgggtgttaacaaccgaaacttgaagacctttgtgacctcgatcgat
acgtcgcttcaactcgctgatcagattcccgaccagtttgtgaaggtgactgaaagtggc
ttgcaggatgccgctacgatggtgaagctctacacagcgggctatcgggccttcctgatt
ggcgaggcgttcatgaaaaccaacgacccggccgccgccctgaccagcctgctcgccgat
taccaacagcaacgtacaacctgtacccaatcgtctctgaccgtatga

DBGET integrated database retrieval system