KEGG   Fibrella aestuarina: FAES_0678Help
Entry
FAES_0678         CDS       T02429                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fae  Fibrella aestuarina
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fae00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:fae00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850796..851320
Genome map
AA seq 174 aa AA seqDB search
MHISLIAAMAQNRVIGRDDATGKPDLPWHLPDDFAYFKRHTLGHAIIMGRKSFEALGKPL
PKRANIIVTRNTAFKPDGATVVHTLDEAIETAKVIEEQGDETRTPEIFVIGGGEIYKAAL
PLATRIYLTEIQRTYDGDTQFPQFDKAQWREVSRHHHPADGRHEAAFDFVVYER
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgcacattagcttaattgcggccatggcccagaaccgcgtgatcgggcgcgatgatgcc
actggcaaacccgatcttccctggcacctgcccgacgattttgcctatttcaagcgccat
acgttgggtcacgctatcattatggggcgcaaatcgtttgaggcgctgggtaagccgctg
cccaagcgggccaatattatcgtgacgcgcaatacggcattcaaacccgatggggccacc
gtggtgcacaccctcgacgaggcgattgagacagccaaagtaattgaagaacagggggat
gaaacccgaacacccgaaatctttgtgattgggggcggcgaaatctataaagcggccctg
ccgttggccacccgtatttacctgaccgaaatccaacgtacctacgacggcgatacgcag
tttccgcagtttgacaaagcgcaatggcgcgaagtgagtcgccaccatcaccccgccgac
ggacgccacgaagccgcgttcgattttgtggtatacgaacgataa

DBGET integrated database retrieval system