KEGG   Fibrella aestuarina: FAES_0682Help
Entry
FAES_0682         CDS       T02429                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
fae  Fibrella aestuarina
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FAES_0682
   00051 Fructose and mannose metabolism
    FAES_0682
Enzymes [BR:fae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     FAES_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(854219..855559)
Genome map
AA seq 446 aa AA seqDB search
MAQINLTLGDKAYFPFVEKPIAYEGRDSDNPLAFKFYNPAQTIMGMPMKDLFRFAVAYWH
TFCGTGADPFGPGVKHFPWDAGKDPLGAAFQKADAAFEFITKMGIEYYCFHDVDVAPEGD
SNHDFESNFRKVVDYLKQKQQASGVNLLWGTANLFSHERYMNGASTNPDFHVLAHGAWQV
KNAIDATIELGGRGYTFWGGREGYMSLLNTNMKREQEHLGRFLQVSRDYARKQGFKGAFY
IEPKPMEPTKHQYDFDAATVVGFLNKYGLQDDFELNLETNHATLANHTFAHELQVAVDNN
MLGSIDANRGDYQNGWDTDQFPVDVYELTEAMLVILEAGGFKSGGVNFDAKTRRNSTDLD
DIFIAHIGGMDTFARAAIAAEAILTKSKYKQLRTDRYASYDSGAGADFEAGKLTLEDLRQ
YAIDNGEAKQVSGKQELYEMIVNQYI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatcaatctgacactcggcgacaaggcctatttcccgttcgtcgagaaaccc
atcgcctacgaaggacgcgactcggataacccgctggcgttcaaattctacaaccccgca
cagaccatcatgggcatgcccatgaaagacctgttccgctttgcggtggcctactggcac
accttctgcggcaccggggccgatccctttgggccgggcgtgaagcacttcccctgggat
gccgggaaagacccactgggcgccgctttccagaaagccgacgccgccttcgagtttatt
acgaagatgggcatcgaatactactgcttccacgacgtcgacgtagcgcccgaaggcgac
tcgaaccacgattttgaaagcaatttccgtaaggttgtcgattatctgaagcagaagcag
caggcgagcggcgttaacctgctctggggcacggccaatctcttctcgcacgagcggtac
atgaacggcgcaagcaccaaccccgatttccacgtgctggcgcatggtgcctggcaggta
aaaaacgccatcgacgccaccatcgaactcggtggccgtggctacaccttctggggtggc
cgcgaaggctacatgtcgctgctcaacaccaacatgaagcgcgagcaggagcacctgggc
cgcttcctgcaggtgagccgcgattatgcccgcaagcagggtttcaaaggcgcgttctac
atcgagcccaagccgatggagccgactaagcaccagtatgatttcgacgcggctacggtc
gtgggcttcctgaacaaatacgggttgcaggacgattttgagctaaacctcgaaaccaac
cacgctaccctggccaatcatacctttgcgcacgagttgcaggtagcagtcgacaacaac
atgctcggcagcatcgacgccaaccggggtgactaccagaacggctgggataccgaccaa
ttccccgtcgacgtgtatgaactgaccgaagccatgctcgtgattctggaagcgggtggc
ttcaaatcgggtggggtgaacttcgacgccaaaacgcgccggaactcaaccgatctggac
gatatcttcatcgcccatatcggcgggatggataccttcgcccgggccgctattgccgcc
gaagccatcctgaccaagtcgaaatacaagcaactccgtactgatcgctacgccagctac
gacagcggggccggtgccgacttcgaagcgggtaaactgaccctcgaagacctccgccag
tatgccatcgacaacggcgaagccaagcaggtcagcggtaagcaggaactctacgagatg
atcgtgaaccagtacatttaa

DBGET integrated database retrieval system