KEGG   Fibrella aestuarina: FAES_0887Help
Entry
FAES_0887         CDS       T02429                                 

Gene name
galA1
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fae  Fibrella aestuarina
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FAES_0887 (galA1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    FAES_0887 (galA1)
   00600 Sphingolipid metabolism
    FAES_0887 (galA1)
Enzymes [BR:fae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     FAES_0887 (galA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108944..1111172
Genome map
AA seq 742 aa AA seqDB search
MKYSLTLLGILFASVGALAQPSAQQRIHYDETKRQFSLENSLVKRVLQLTPSGLQTVAYT
DLRTKTNVIRDPNRVREIAFQVNGIPFTGRGAAGFAVTYKTHTISEKVGQGSVLRVDLQV
QHPNRFIVFDLSLYYQIYADLPLTRKWLTIRNTGGDPLRISELDWENLNLDLTAGGVGLT
TAVDVYAAYGRLPTRPPYIGRTDDAALLIHNPEQNTGILLGNEAPAVMKRTHVYRDSTEV
GIGMGFEADDFPFQKTLLTDETFTSPKAFVSLFKGAVWQDAFAQDLATYVRTQLGTRLFA
HKKTPTAFYNTRLPFGRNLNGPQLKKLVDELAPTGIDYLILDDGWQDNYGDWNVDTRKFP
NGLRPLTDYIRAKGMTPGLWLALATAADTSAVGQEHADWFMNNRDGQRHSLQGSGAKNLY
TMSLDTPWFDYILQKIRTLVDEHGLGYIKLDLAAACSAYRLNSSDAGDWATGAGRTYANQ
RESLWRLYERTGQLMDSLKASHPNLLIDCTHELYGKANGVDLWLLQHADYAGLASNRIGA
SAGSRALRQLTYDRGQVVPSGTLLTGNLRLDEPLAKQQYLSMASSTIVFTGDVAKLLPTD
KAWLKAWNGWLAALNERTQYTRFYQTGDVLPRPDTHNWDGAIRFNPERNGGLLCFYRNDS
PEATRIFPIRGVKPAGTYLIRQGGTNAVVGTFTGQQLLTTGLPVTIPNRNEASLLSIEPF
VKPEAAKVEPIAAKEPAKMPVK
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacagcctcactctactcgggattcttttcgcgtctgtgggcgcattggcccag
ccatcagcgcaacaacgcatccactacgatgaaaccaagcgccagtttagtctcgaaaac
tcgctggtgaaacgggtgcttcaactgacgccgtcggggctgcaaacggtagcctacacc
gatctgcgcacaaagaccaatgtgatccgcgacccaaatcgagtgagggagatagctttt
caggtcaacggtatacccttcacggggcgcggggcggcgggctttgccgtgacgtataaa
acccacacaatcagcgagaaagtcgggcaggggagtgtgttgcgcgttgatttacaggtg
cagcatcccaaccggtttatcgtgttcgacctaagcctgtactaccagatttacgccgat
ctgcccctgacgcgcaaatggctgacgatcagaaatacgggcggcgatccattgcgtatc
agtgagctggactgggaaaacctgaacctcgacctaacggcgggtggagtgggtctcacc
acggcggttgatgtgtacgcagcctacgggcggctaccgacccggcccccttacattggg
cgtaccgacgatgctgcgttgctgattcataaccccgaacaaaacacaggtatactgttg
ggcaatgaagccccggcggtgatgaagcggactcatgtataccgggattctaccgaagta
gggattggcatggggttcgaagccgacgattttccgtttcagaagaccctactaaccgac
gaaacctttacctcgcccaaagccttcgttagcttgttcaaaggggctgtctggcaggat
gcctttgcgcaggatctggccacctacgtgcgtacgcagctgggcacacggttgtttgcg
cacaagaaaacgccaacggctttctacaacacccggcttccgtttgggcgtaaccttaat
ggcccacaactcaaaaagctcgtcgatgagctggcccccacgggcattgattacctgatt
ctggacgacggctggcaggataactacggcgactggaacgtggatacccgcaagtttccg
aacggcctgcgccccctgactgactacatccgcgccaaagggatgacgcccggtttatgg
ctggcactggccaccgccgccgatacctcggcggtagggcaggaacacgccgactggttc
atgaacaaccgcgacgggcaacgccattctttacagggtagcggtgctaaaaacctgtac
acgatgagcctcgataccccctggttcgattatatacttcagaaaatcagaacgttggtt
gatgagcatggacttgggtacatcaagctcgacctggcggcagcctgttcggcttatcgg
ctcaacagcagcgatgcgggcgactgggccacgggtgctggacgtacctacgccaatcag
cgggaatcgttgtggcggctttatgaacgcacgggtcagcttatggattcgctcaaagcc
agccaccctaacctgctgatcgactgcacccatgaactgtacggaaaggccaacggcgtc
gatctgtggctgctacaacacgccgattacgccgggctcgcgtcgaaccggataggggca
tcggcgggaagtcgtgcccttcggcagttgacctacgatcgggggcaggtggtgccgtca
ggtacgttgctgacgggtaacctgcgcctcgatgagccactggccaaacagcagtacctg
tcgatggcttcttcgaccattgtcttcaccggcgacgttgccaaactgcttcctactgat
aaagcgtggctcaaagcctggaacggctggctggcggcgctcaacgaacgtacccagtat
acgcgattctaccagacgggcgatgtcctgccccgacccgatacgcacaactgggacggt
gccatccggttcaaccccgagcgtaacggggggctgctgtgtttttaccgcaacgattcc
cctgaagcaacccgcatcttcccgatccgaggcgtgaaaccggccggtacgtacctgatt
cggcagggtgggaccaacgccgtcgtgggtacgttcacggggcagcaactgctcactaca
ggcctgccagtcacgattccgaaccgcaacgaagcctccctgctctccatcgaaccgttc
gtaaaacccgaagccgccaaagttgagcccatcgctgccaaagaacccgccaagatgccg
gtgaagtag

DBGET integrated database retrieval system