KEGG   Fibrella aestuarina: FAES_1227Help
Entry
FAES_1227         CDS       T02429                                 

Definition
Glycogen(starch) synthase (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
fae  Fibrella aestuarina
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FAES_1227
Enzymes [BR:fae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     FAES_1227
Glycosyltransferases [BR:fae01003]
 Polysaccharide
  Storage polysaccharide
   FAES_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1522866..1524680
Genome map
AA seq 604 aa AA seqDB search
MEALFSTSKRKLLLEVAWEVCNQVGGIYTVIRSKVPAMVEKWDDNYVLLGPYFPQKAAAE
YEPITEPDETEIGQTVRKMRQLGYEVEYGYWLVTGRPRVVLFNLQSMTSQLDALKAGLWE
RHKLPTLGVEDLVNQTLAFGEMVRVFIKLLADDHARRVDMAAHFHEWMAASGLPELRREN
VKVATVFTTHATMLGRYLAQNETNFYGRLDSFDWQKEARHYGIEAQATIERLAALQSHVF
TTVSDVTARECEVFLGRNPDLILPNGLNVTRFAAAHEFQNLHVRYKERIHEFVMGHFFQN
YSFDLDKTLYFFTSGRFEFSNKGYDLTLEALARLNWRMREANMDITVVMFMVTKQPYRSI
NPEVLHTRALLDEIRETSQAIEKQVGERLFLASASGSETSLPDLNKFVDEYWRLRLRRTV
QSWKTKQLPRFVTHDLLQEDDMTRFIRQANLVNNEYDRVKIVYHPDFIASTNPLFGLDYS
QFVRGCHLGIFPSYYEPWGYTPLECVVRGIPTVTSDQSGFGDFIMQIMRDYENRGIYVVN
RKTQNFDEAANQLADILYRFVRMSMRDRIQQRNRVESISDVFDWTNLRSYYDTAHDLALK
RRKP
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtggaagcactcttctcgacatcgaagcgaaaactcctgctcgaagtagcctgggaggtt
tgtaatcaggttggcggcatttacaccgttattcgctcgaaagtacccgctatggttgag
aagtgggacgacaactacgtgttgctggggccttactttccgcaaaaagccgctgccgag
tatgaacccattactgaacccgacgaaacggaaattgggcagactgtccgcaaaatgcgc
cagcttggctacgaagtcgagtatggctactggctcgtaacgggccgcccgcgggtggtg
ttgttcaacctgcaaagcatgaccagccagctcgacgcgctcaaagctggcctttgggaa
cgccataagctgcctacgctgggcgtagaagacctcgttaatcagacgctggccttcggc
gaaatggtgcgggtatttatcaaactcctggccgacgaccacgctcgccgcgtggacatg
gcggcccattttcacgagtggatggcggcatcgggcctacccgagctgcgccgcgaaaac
gtgaaagtcgccaccgtatttaccacgcacgcaaccatgctgggccgctacctggcacag
aacgaaaccaatttttacggccggctggattcgttcgactggcagaaagaagcccgccat
tacgggattgaagcgcaggctaccatcgaacggctggcggctttgcagagccacgtgttt
accaccgtcagcgatgttacagcccgcgaatgtgaagttttcctgggacggaatcctgat
ctgattctgcccaacggcttgaacgtgacgcgctttgccgctgcccatgagttccagaac
ctgcacgttcggtacaaagagcgcattcacgaatttgtgatgggccactttttccagaac
tactcgttcgacctcgacaagacgctgtacttcttcacgtcggggcggtttgagttcagc
aacaaagggtatgacctgacgctcgaagcgctggcccggctcaactggcgaatgcgcgaa
gccaacatggatatcacggtggtgatgttcatggtgacgaagcagccctaccgctcgatt
aaccccgaggtgctgcacacccgcgccctgctcgacgaaatccgcgagaccagtcaggcg
attgagaaacaggtgggcgagcgccttttcctggcgtcggcgtcgggcagcgaaaccagc
ctgcccgatctcaacaaatttgtggatgaatactggcggctgcgcctgcggcggacggtg
caaagctggaagaccaagcagttaccccgctttgtcacgcacgacctgttgcaggaagac
gacatgacccgcttcatccggcaggccaacctcgtcaacaatgagtatgaccgggtgaaa
atcgtctatcaccccgatttcatcgcgtcgaccaatccgctctttgggctcgattacagt
cagtttgtgcgggggtgccacctcggcatttttcccagctattacgaaccctggggctat
acgccgcttgaatgtgtggtacgcggcattccgaccgtcacgagcgaccaatcgggcttt
ggcgatttcatcatgcagatcatgcgcgactacgaaaaccggggcatctacgtggtgaat
cgcaagacgcagaatttcgacgaagctgccaaccagctcgccgacattctgtaccgattt
gtcagaatgagcatgcgcgaccggattcagcaacgaaaccgggttgagagcatttccgac
gtttttgactggaccaacctccgttcgtactacgatacggcgcacgatctggctctaaag
cggcggaaaccgtaa

DBGET integrated database retrieval system