KEGG   Fibrella aestuarina: FAES_1608Help
Entry
FAES_1608         CDS       T02429                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
fae  Fibrella aestuarina
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FAES_1608
   01212 Fatty acid metabolism
    FAES_1608
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FAES_1608
   00650 Butanoate metabolism
    FAES_1608
  Lipid metabolism
   00071 Fatty acid degradation
    FAES_1608
   01040 Biosynthesis of unsaturated fatty acids
    FAES_1608
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FAES_1608
   00310 Lysine degradation
    FAES_1608
   00380 Tryptophan metabolism
    FAES_1608
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FAES_1608
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FAES_1608
   00281 Geraniol degradation
    FAES_1608
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    FAES_1608
Enzymes [BR:fae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     FAES_1608
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FAES_1608
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     FAES_1608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2000907..2003057
Genome map
AA seq 716 aa AA seqDB search
MINYTVEQNVAVIRWNLTSSPMNVLNDESIPQFEEALNRAYADEAVKGIIITSDKPEFVA
GADLKMILRNNDKDPAEMLKVSAELNRIFRGIETSGKPAVAAINGTALGGGYEICLACHY
RVALNNPKTQIGLVEVTIGLLPGAGGTQRLPRMIGMQAALPLLVEGKKLNVQDALKAGLV
DDIAETPTTMMDKARAWILANPQPVKPWDQIDKKTGRIAARDNFKVPGGNVQSPVGAQTF
AAGTAMLMDKTKGNYPAPLEIMACVYEGLQVNIDRALAIEARHFVKVATSKVAKNLIGTM
FLGMNEANKGASRPKDVLRTDVKKLGILGAGMMGAGIAYVSALAGIEVVLKDVSVEAAEK
GKDYSRNLLKKGVERGKVDPLSVDATLNRIKPSADYADMQGCDLIIEAVFENRDLKATVT
KEAEPMLADNSVFGSNTSTLPITGLAEASQNPANFIGIHFFSPVDKMMLVEIIVGKQTSE
YALAVAMDYTRKIRKTPIVVNDSRGFYTSRCFGTYTAEGMELLRDGVNPILIENAGKAAG
MPVGPLAVTDEVALDLVYKISGQSIKDGVLSETDTSYQVAKQFVGLGRLGKKAKAGFYDY
PDDGSPKQLWPDLAKLFPLADQQPSLDEVKTRLLYRQAIEAVRCYEEGVIRTQLDANLGS
ILAWGFPAYTGGALAFVDFVGVGTFVSTLDRLADQYGERFRPTEKLRERAGVKATA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgattaactacacggtcgagcaaaacgttgcggtcatccgctggaacctcaccagcagc
ccgatgaacgtgctgaacgacgaatcgatcccgcaattcgaggaagccctcaaccgcgcc
tacgccgacgaggccgtcaaaggcatcattatcaccagcgacaaaccggagttcgtcgct
ggtgccgatctgaaaatgatcctgcgcaacaacgataaagatcccgctgagatgctaaag
gtatcggcggaactgaaccggattttccgtggcatcgaaacaagcggcaaacccgccgtg
gcggccatcaacggtacggcgctgggcggcggttatgagatttgcctggcctgccactac
cgcgtcgcactcaacaaccccaaaacccagatcgggctggtcgaggtgacgatcgggctg
ctgccgggtgcgggcggcacccaacgcctgccgcgcatgatcgggatgcaggccgcgttg
ccgttactggtagaaggcaaaaagctgaacgtgcaggatgcgctgaaagccggcctggtc
gatgatattgccgaaacgcccacgacgatgatggacaaggctcgcgcttggatactggcc
aatccgcagcccgtcaaaccgtgggatcagatcgataagaaaacgggcaggatcgcggcc
cgcgataatttcaaagtgccggggggcaacgtgcaaagtccggtgggggcgcagaccttc
gcggcgggcacggccatgctgatggacaaaaccaaaggcaattaccccgccccgctcgaa
attatggcctgcgtgtacgaaggtttgcaagtcaacatcgaccgggcactggccatcgaa
gcgcggcattttgtgaaagtagcgacctcgaaagtggccaagaacctgatcgggacgatg
ttcctgggcatgaacgaggccaacaaaggcgcaagccgccccaaagacgttctgagaacc
gacgtgaagaaactcggtatcctgggcgcgggcatgatgggcgcgggcatcgcctacgtg
tcggcgctggcgggaatcgaggtggtgctgaaagatgtgtcggtcgaggcggcggagaag
gggaaagactattcgcggaacctactgaagaaaggcgtcgagcgcggcaaagtcgatccg
ttgagcgtcgacgccacgttgaaccgcatcaaaccctccgccgattacgccgacatgcag
gggtgcgacctgatcatcgaggccgtcttcgaaaaccgcgacctgaaagccaccgtcacg
aaagaagccgagccgatgctggccgacaacagcgtttttggctctaatacatccacgcta
cccattaccggcctggccgaggcgtcgcagaacccggccaacttcataggcatccacttc
ttctcgcccgtcgacaagatgatgctggtggagatcatcgtgggcaaacaaacgtcggag
tacgcgctggccgtggcgatggactacacgcgcaaaatccgcaaaacgcctatcgtcgtc
aatgacagtcggggtttctacacgtcgcgctgttttggtacctacacggctgaaggtatg
gaactgctgcgcgatggtgtcaacccgatcctgatcgaaaacgcgggcaaagccgccggg
atgcccgtgggtccgctggccgtgaccgacgaagtggcgctcgatctggtgtacaagatt
tcgggacaaagcatcaaggacggcgtcctgagcgagaccgatacaagctatcaggtcgct
aaacagtttgtcgggttgggccgactgggtaaaaaggctaaagctggtttttacgactac
cccgacgatggcagccccaaacaactctggccggacctggccaaactgttcccgctggcc
gaccaacaaccgagtctcgacgaggtgaagacccggctgctctatcggcaggccattgag
gcggtacgttgctacgaggaaggcgtgatacgtacccaactcgatgccaacctcggctcc
attctagcgtgggggttcccggcgtatacgggtggggcgttggcgtttgtcgacttcgtg
ggcgtaggtacgttcgttagtacgctcgaccgcctggccgatcagtacggcgagcgcttc
cggcctactgaaaagctgcgcgaacgagctggtgtgaaagccactgcctga

DBGET integrated database retrieval system