KEGG   Fibrella aestuarina: FAES_1865Help
Entry
FAES_1865         CDS       T02429                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit,dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fae  Fibrella aestuarina
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FAES_1865
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FAES_1865
  Amino acid metabolism
   00310 Lysine degradation
    FAES_1865
Enzymes [BR:fae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FAES_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2296464..2298125)
Genome map
AA seq 553 aa AA seqDB search
MAAIEVKVPAVGESITEVTVGEWLKKEGDTVKVDEVLCTLDSDKASFELPAEAEGVLHIM
AQAGDVLPIGATICTIDAAGAAPAASAPAAPQAEAPKADATPAQPAPEPQPAVQAVAEPA
AAPAQPSTAASTIEVKIPAVGESITEVTIAAWSKKDGDSVSMDETLCELESDKATFELPA
EAAGTLRIVAEAGQTLPIGATIARIEASASTGAAQPSGTSAPAAPAAQPQAANGSSNGSY
AANYPSPAAAKILAEKGVEPAQVAGTGVGGRITKEDAQKASAAPAPQPAPAQPAPAAQKP
AAPAPAPQAPSAPGSPDRTGQRTQRREKMTSLRKTIARRLVAVKNETAMLTTFNEVDMKP
IMDLRAKYKDKFKEKHAVGLGFMSFFTKAVCIALQEFPAVNAMIDGDQMVYNDFCDISIA
VSSERGLVVPVIRNAEQLSFDGIEKEIIRLAGLARDNKLTIEQMQGGTFTITNGGIFGSM
LSTPIINAPQSAILGMHNIVERAVVVNGEIVVRPIMYVALSYDHRIIDGKESVSFLVRVK
QLLEDPTRILLGV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctgctattgaagtaaaagtgcccgctgtaggtgagtcgatcacggaggtaacggtg
ggtgaatggttgaagaaagagggtgatacggtaaaggtcgatgaggtgctttgcacgctc
gattccgacaaagcatcgtttgaattaccggccgaagccgaaggtgtgctacacattatg
gcgcaggccggcgacgtgctgcccattggcgcgaccatctgcaccatcgatgctgccggt
gctgcacccgcagcctccgcccctgccgccccccaggccgaagcgcccaaggctgacgca
acacccgctcaaccagcccccgagccgcaaccggcggttcaggctgtagccgagcccgcc
gctgcgccagcgcagccgtcaacggccgccagcacgatcgaggtaaaaattccggccgtt
ggtgaatcaatcaccgaagtgaccattgccgcctggagcaaaaaagacggcgacagcgtg
tcgatggacgaaaccctctgcgagttggaatccgacaaggccacgtttgaattgcccgcc
gaagccgccggtacgttgcgtatcgttgccgaagccggtcagacgctgcccatcggcgcg
accatcgcccgcattgaagccagcgcgtcaacgggtgcagcgcagccgtcaggtacgtcg
gcaccagccgctccggccgcacagcctcaggctgccaacggcagcagcaacggtagctac
gccgccaattacccgtcgcctgccgccgccaaaattctggccgaaaaaggcgttgagccc
gcgcaggtagccggtaccggcgttggcggtcggatcacgaaagaagacgcccagaaagcc
agcgccgcgccagcgccacaaccggctccggctcagcctgcccccgcggcgcagaagccc
gccgcaccggcgcccgcaccgcaggctccgagcgcccccggatcgccggaccgtaccggc
caacgtacccagcggcgcgagaaaatgacctcgctgcggaaaacgattgcccgccgcctg
gtggccgtgaaaaacgaaacggccatgctgacgaccttcaacgaggtcgatatgaagccg
atcatggatctgcgcgccaagtacaaagacaagttcaaggagaagcacgccgtgggcctc
gggttcatgtcgttcttcacgaaagcggtctgcatcgcgttgcaggagttcccggccgta
aacgccatgatcgacggtgatcagatggtgtacaacgatttttgcgatatctcaattgcg
gtatcgtcggagcgcggtctggtggtgcccgttattcggaacgccgagcaactgtcgttt
gacggtatcgagaaggagatcatccggttggcgggtctggcccgtgataacaaactgacc
atcgaacagatgcagggcggtacgttcacgatcaccaacggcggtattttcgggtcgatg
ctgtcgacgccgatcatcaacgcgccgcaatcggccattctggggatgcacaacatcgtg
gagcgggctgtcgtcgtgaatggcgagatcgtcgttcggccgatcatgtacgtggccctc
agctacgaccaccgcatcatcgacggtaaagagtcggttagcttcctggtgcgcgtgaag
caactgcttgaagatccgacccgcattttgctgggtgtttaa

DBGET integrated database retrieval system