KEGG   Fibrella aestuarina: FAES_1935Help
Entry
FAES_1935         CDS       T02429                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fae  Fibrella aestuarina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FAES_1935
Enzymes [BR:fae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FAES_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2383147..2383932
Genome map
AA seq 261 aa AA seqDB search
MSQTSTQTTEERQTKVSQVLVTQSKPADDKSPYFELASKYNITIDFRPFIQIQGVSFKDF
RRNKVNILDHTAIIFTSRNAIDHFFRICQEGRIEVPADMKYFCISEQTANYLQKYIVIRK
RKIFSGTKTAKELFDLIRKHKTEKFLFPCSNIRSNDIPDFMDTSGLHLTEAVMYETVATD
LSDLDINQYDLIAFFSPSGVASLKSNFPDYQQNGTRLAAFGPTTAKAIVEAGLTLDIEAP
LPNAPSMTGALDLYIRKANNP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaccagcactcagaccacagaagagcgccagaccaaagtcagccaagtatta
gtaactcaatctaagcccgccgacgacaaatcgccttatttcgaattagcctctaagtat
aacattacgatcgactttcgcccgttcattcagattcagggcgtatccttcaaagatttt
cgccgtaataaggtcaacattcttgaccacacggcgatcatctttaccagccgtaatgcc
atcgaccacttcttccggatttgccaggagggccgtattgaggtgcctgccgatatgaag
tatttctgcatctccgaacagacggccaattacctccagaaatacatcgtcatccggaag
cggaaaatcttttcgggcacgaaaaccgctaaagaacttttcgatctgattcggaagcat
aagaccgagaagttcctgttcccctgctcgaacatccgcagcaacgatattcctgatttt
atggacacaagcggtttgcacctcacggaagccgtgatgtatgaaaccgtggcaaccgac
ctttccgacttggacatcaaccagtatgatctgattgcgttcttcagcccgtcgggggta
gcctcgttgaaaagtaactttcctgattatcagcagaatggtacgcggctggcggcgttt
ggccccaccaccgccaaagcgatcgtggaagccggcctgacgctcgatatcgaagcgccg
ctgcccaatgcgccttcgatgaccggcgcgttggacctctacattcgaaaagccaacaat
ccgtaa

DBGET integrated database retrieval system