KEGG   Fibrella aestuarina: FAES_2024Help
Entry
FAES_2024         CDS       T02429                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fae  Fibrella aestuarina
Pathway
fae00020  Citrate cycle (TCA cycle)
fae00310  Lysine degradation
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01120  Microbial metabolism in diverse environments
fae01130  Biosynthesis of antibiotics
fae01200  Carbon metabolism
Module
fae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FAES_2024
  Amino acid metabolism
   00310 Lysine degradation
    FAES_2024
Enzymes [BR:fae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FAES_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CCH00033
UniProt: I0K7D0
Position
2494748..2496175
Genome map
AA seq 475 aa AA seqDB search
MALIDLVMPKMGESIMECTVITWLKKPGDRFDADESLLEVATDKVDTEVPAPYAGVLKEL
LVNDGDVVPIGQPIARIETSEAVGADDTPANAPTGGDAAPLPSLEEVGVDAAAVNDVEEA
EAVASAAELEASIGAMSSKSAAAQPGNVPAFEGRFYSPLVLNIAKEEGISRAELDRIPGS
GSDNRVTKKDMLAYVLDRAASSKGQGMPAAQGMAGNVPVHQSPPPPATPAVKPVPAQSLN
GSADIIQMDRMRKMIAQRMVESKQISPHVTSFVEADLTAVVQWRAANKDAFKKQTGENLT
YTPILIDAIVKAVRDFPMINVSVEGDSILVKKAINVGMAVALPTGNLIVPVIHDAAQYNL
IGLTKKVNDLSKRARENKLTADDLAGGTYTVSNIGTFGNLMGTPIIMQPQVAIMAFGAIV
KKPAVIETPQGDLIGIRHMMFLSHSYDHRVVDGALGGQFVRRVADYLEQWNEPNL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcccttattgatctggtaatgcccaaaatgggcgagagtattatggaatgcacggtc
atcacgtggctcaaaaagcccggtgaccgctttgacgccgacgaatcgctgctggaagta
gcgaccgacaaggtggatacggaagtacccgcaccctacgctggcgtgctgaaagaactg
ctggttaacgacggcgacgtggtgcccattggccagcccattgcccgcatcgagacgtcg
gaggcggtaggcgcagatgatacccccgccaacgcaccaacgggtggcgatgcggccccg
ctgccgtcgctggaagaggtgggcgtggatgctgccgcggtcaacgacgtggaagaggcc
gaagcggtggcgagtgccgctgaactggaggccagcatcggcgccatgagcagcaaatcg
gcggcggcgcaaccaggcaacgtacctgcatttgaagggcggttctattcgcccctggtg
ctgaatatcgccaaagaagaaggcatcagccgcgccgaactcgatcgcattcccggcagc
ggctccgacaaccgggtgaccaagaaagacatgctggcgtatgtgctcgaccgcgcagcg
tcgagcaaggggcaggggatgcctgcggcgcagggcatggccgggaacgtaccggtccac
caatccccgccgccccccgctacccctgcggtgaagccagtccccgcccaaagcctgaat
ggttcggccgacatcattcagatggaccggatgcggaagatgattgcgcagcggatggtg
gagtcgaagcagatttcgccgcacgtgacctcgtttgtcgaggccgacctgaccgccgtg
gtgcagtggcgcgcggccaacaaagacgcgtttaagaaacagaccggcgaaaacctgacg
tacacgcccatcctgatcgacgccattgtgaaggccgttcgcgatttcccgatgatcaac
gtatcggtagagggcgacagcattctggtgaagaaagcgatcaacgtgggcatggccgtg
gcgctgccaacgggtaacctgatcgtgccggtcattcacgacgcggcccagtataacctc
atcggcctgaccaaaaaggtcaacgacctgagcaaacgcgcccgcgaaaacaaactcacc
gccgacgatctggcgggtggcacctacaccgtttccaacatcggtacgtttggcaacctc
atgggtacgcccatcatcatgcagccgcaggtggcgattatggccttcggggcaatcgtg
aagaagcccgccgtgatcgaaacgccgcagggcgacctgatcggcatccggcacatgatg
ttcctgagccattcctacgatcaccgcgtggtcgatggcgcgttgggcgggcagtttgtc
cggcgcgtagccgactacctggagcagtggaacgaaccaaacctataa

DBGET integrated database retrieval system