KEGG   Fibrella aestuarina: FAES_2024Help
Entry
FAES_2024         CDS       T02429                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fae  Fibrella aestuarina
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:fae01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fae00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fae00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2494748..2496175
Genome map
AA seq 475 aa AA seqDB search
MALIDLVMPKMGESIMECTVITWLKKPGDRFDADESLLEVATDKVDTEVPAPYAGVLKEL
LVNDGDVVPIGQPIARIETSEAVGADDTPANAPTGGDAAPLPSLEEVGVDAAAVNDVEEA
EAVASAAELEASIGAMSSKSAAAQPGNVPAFEGRFYSPLVLNIAKEEGISRAELDRIPGS
GSDNRVTKKDMLAYVLDRAASSKGQGMPAAQGMAGNVPVHQSPPPPATPAVKPVPAQSLN
GSADIIQMDRMRKMIAQRMVESKQISPHVTSFVEADLTAVVQWRAANKDAFKKQTGENLT
YTPILIDAIVKAVRDFPMINVSVEGDSILVKKAINVGMAVALPTGNLIVPVIHDAAQYNL
IGLTKKVNDLSKRARENKLTADDLAGGTYTVSNIGTFGNLMGTPIIMQPQVAIMAFGAIV
KKPAVIETPQGDLIGIRHMMFLSHSYDHRVVDGALGGQFVRRVADYLEQWNEPNL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcccttattgatctggtaatgcccaaaatgggcgagagtattatggaatgcacggtc
atcacgtggctcaaaaagcccggtgaccgctttgacgccgacgaatcgctgctggaagta
gcgaccgacaaggtggatacggaagtacccgcaccctacgctggcgtgctgaaagaactg
ctggttaacgacggcgacgtggtgcccattggccagcccattgcccgcatcgagacgtcg
gaggcggtaggcgcagatgatacccccgccaacgcaccaacgggtggcgatgcggccccg
ctgccgtcgctggaagaggtgggcgtggatgctgccgcggtcaacgacgtggaagaggcc
gaagcggtggcgagtgccgctgaactggaggccagcatcggcgccatgagcagcaaatcg
gcggcggcgcaaccaggcaacgtacctgcatttgaagggcggttctattcgcccctggtg
ctgaatatcgccaaagaagaaggcatcagccgcgccgaactcgatcgcattcccggcagc
ggctccgacaaccgggtgaccaagaaagacatgctggcgtatgtgctcgaccgcgcagcg
tcgagcaaggggcaggggatgcctgcggcgcagggcatggccgggaacgtaccggtccac
caatccccgccgccccccgctacccctgcggtgaagccagtccccgcccaaagcctgaat
ggttcggccgacatcattcagatggaccggatgcggaagatgattgcgcagcggatggtg
gagtcgaagcagatttcgccgcacgtgacctcgtttgtcgaggccgacctgaccgccgtg
gtgcagtggcgcgcggccaacaaagacgcgtttaagaaacagaccggcgaaaacctgacg
tacacgcccatcctgatcgacgccattgtgaaggccgttcgcgatttcccgatgatcaac
gtatcggtagagggcgacagcattctggtgaagaaagcgatcaacgtgggcatggccgtg
gcgctgccaacgggtaacctgatcgtgccggtcattcacgacgcggcccagtataacctc
atcggcctgaccaaaaaggtcaacgacctgagcaaacgcgcccgcgaaaacaaactcacc
gccgacgatctggcgggtggcacctacaccgtttccaacatcggtacgtttggcaacctc
atgggtacgcccatcatcatgcagccgcaggtggcgattatggccttcggggcaatcgtg
aagaagcccgccgtgatcgaaacgccgcagggcgacctgatcggcatccggcacatgatg
ttcctgagccattcctacgatcaccgcgtggtcgatggcgcgttgggcgggcagtttgtc
cggcgcgtagccgactacctggagcagtggaacgaaccaaacctataa

DBGET integrated database retrieval system