KEGG   Fibrella aestuarina: FAES_2088Help
Entry
FAES_2088         CDS       T02429                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fae  Fibrella aestuarina
Pathway
fae00010  Glycolysis / Gluconeogenesis
fae00020  Citrate cycle (TCA cycle)
fae00620  Pyruvate metabolism
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01120  Microbial metabolism in diverse environments
fae01130  Biosynthesis of antibiotics
fae01200  Carbon metabolism
Module
fae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FAES_2088
   00020 Citrate cycle (TCA cycle)
    FAES_2088
   00620 Pyruvate metabolism
    FAES_2088
Enzymes [BR:fae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FAES_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 HlyD_3 PYNP_C QRPTase_N GCV_H
Motif
Other DBs
NCBI-ProteinID: CCH00097
UniProt: I0K7J4
Position
2582453..2584219
Genome map
AA seq 588 aa AA seqDB search
MAELIRMPKMSDTMTEGVIAEWHKKVGDTVKSGDVLAEVETDKATMDLEAYDEGTLLYIG
IEKGQSVPVDGIIAVIGQQGEDFQSLLNGSSGGSVEAPAPKAESTAPADKPAPTAADTTQ
VNTNMADEKAVSAAPAADANVNASVIRMPKMSDTMTEGTIVAWHKKEGDTVKSGDVLAEV
ETDKATMDLEAYEEGTLLYVGVKEGESVAVDAVIAVVGEKGANFKVLISGAESSGAAPAA
ESAGSGNATAEQNPQTNVPANADTDLSYAGGTENGHDANGRVKASPLAKAIAEQKGIDLK
QVHGTGPEGRIVKADVEAFKPGTSAQPAAASAAQPAAPQAQPAQAPAAATPAPAPQPQAT
PQGEYEDVPVSQMRKTIARRLSESLFTAPHFYLTMEINMDKAMALRGQVNAVAPAKVSFN
DFVIKAAALALKQHPNVNSSWLGDKIRKYKYVNIGVAVAVDEGLLVPVVRNADQKTLSTI
AGEVKEMAGKAKDKKLQPKDWEGSTFSISNLGMFGIDEFTAIINPPDSCILAVGAIKQSV
VFEGETPKPVNIMKVTLSCDHRVVDGATGAAFLQTLKGFLEDPMKMLV
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaatccgaatgcccaagatgagcgacaccatgactgagggtgtcattgct
gagtggcataaaaaagtaggtgataccgtaaaatcgggcgatgtgctggccgaagtcgaa
accgacaaagccaccatggacctcgaagcctacgacgaaggcaccctgctttacattggt
atcgaaaaagggcagtcggtgccggttgatggcatcattgccgtgattggtcagcagggc
gaagatttccagtcgctgctcaatggcagcagtggtggcagcgtggaagcgcccgccccg
aaagccgaaagcactgccccggccgataaaccggcccccactgccgccgataccacgcag
gtaaataccaacatggctgatgaaaaggcggtgtcggctgctccggctgccgatgccaac
gtgaacgcgtcggtgattcggatgcctaagatgagcgataccatgacggaaggtaccatc
gtggcctggcacaaaaaggaaggtgataccgtaaaatcaggcgatgtgctggccgaagtc
gaaaccgacaaagccaccatggacctcgaagcttatgaagaaggcaccctgctctacgta
ggcgtgaaagaaggcgaatcggtcgcggtcgacgcggttatcgccgtcgtcggtgagaaa
ggggccaacttcaaagtactcataagcggtgccgaaagcagcggcgcagctccggcggcc
gaatcggctggaagcggcaacgccaccgccgaacaaaacccgcaaaccaacgtacctgcc
aacgccgacaccgacctgtcgtatgccggtggtaccgaaaacgggcacgacgccaacggt
cgcgtgaaggcgtcgccattggccaaagctattgccgagcagaaaggcatcgacctgaaa
caggtgcacggcactggccccgaagggcgtatcgtgaaagccgacgtggaagcgttcaag
ccaggtacgtcggctcaaccggctgcggcctcagcggcccagcccgccgctccgcaggct
cagcccgctcaggcccctgctgcggctacaccggctccggctcctcagcctcaggcaacg
ccccagggcgagtacgaagatgtgccggtgagccagatgcggaaaaccattgcccgccgc
ctgagcgagagcctcttcacggccccgcacttctacctgaccatggaaatcaacatggac
aaggcgatggcgctgcgcggacaggtaaacgccgtggccccggccaaagtctcgttcaac
gatttcgtgatcaaagccgccgcgctggcgctgaagcaacaccccaacgtcaactcatcg
tggctgggggataaaatccgcaagtacaagtatgttaacatcggggtggcggttgccgtc
gacgaagggctgctcgtgccggtggtgcgcaacgccgaccagaaaacgctgtcgaccatt
gccggtgaggtgaaggagatggcgggcaaagccaaagacaaaaagctgcaacccaaagac
tgggagggcagcaccttctcgatctcgaacctgggcatgtttggtatcgacgagtttacg
gccatcatcaacccgcccgattcgtgcatcctcgcggttggggccatcaagcagagtgtc
gtgttcgaaggcgagacgccgaagccggtcaacatcatgaaagtgacgctgtcgtgcgat
caccgcgttgtcgatggggctaccggcgcggccttcctgcaaacgctgaaaggtttcctg
gaagacccgatgaagatgctggtgtag

DBGET integrated database retrieval system