KEGG   Fibrella aestuarina: FAES_2368Help
Entry
FAES_2368         CDS       T02429                                 

Gene name
nagC
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fae  Fibrella aestuarina
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FAES_2368 (nagC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FAES_2368 (nagC)
   00052 Galactose metabolism
    FAES_2368 (nagC)
   00500 Starch and sucrose metabolism
    FAES_2368 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    FAES_2368 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FAES_2368 (nagC)
   00524 Butirosin and neomycin biosynthesis
    FAES_2368 (nagC)
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FAES_2368 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2949944..2950894
Genome map
AA seq 316 aa AA seqDB search
MKTLAIGIDIGGTRTKIGLVDLASGVVDAMLVTPTETKNGEQFLQRIGTAISQLKDKAIA
ELTQLAGVGIGVPGFVFANGVVDSTYGFLEFMEDYPLASYIQERHGLPCLLDNDARVVAL
GEATFGQGERFSRVLVLTLGTGLGLGLTVDGRLDGPLPYAHMGGHLTITTNDTVCYCGKT
GCLESLVSSAGLLRIANRLGWSPEQAGLPPTAETIFNQKKAGNPLAGAIVDEYIGYLQTG
IDNYVNLYAPDIIVLGGGMAKGLTGETDRLHNARLLSPYKAYKTRVTISDLEEKAGIVGS
ALLFKPERLAPLPNES
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacactggcgatcggtatagacattgggggcacccggacaaaaatcgggctggtc
gacctggccagcggtgtggtcgacgccatgctcgttacgcccaccgaaaccaaaaacggg
gagcagtttctgcaacggatcggtactgccatcagccagctcaaagacaaagccattgcc
gaacttacccaactggcgggggtgggcatcggtgtgccgggctttgtgtttgccaacggt
gtcgtagactccacgtacggctttctcgaattcatggaggattatccgctagccagctat
attcaggagcgacacgggctgccctgtttgctcgacaacgacgcccgcgtggttgcactg
ggcgaggcgacatttggccagggggagaggtttagccgtgttttggtcttaacgctgggc
acgggccttgggctgggtcttacggtcgatggcaggctcgatggtccgctgccctatgct
cacatgggcggccacctgaccatcaccaccaacgatacggtttgctactgtggcaaaacg
ggctgtctggagtcgctggtatcatcggccggtctgctgcgtatcgcgaaccggctgggc
tggtcgccggagcaggcgggtttgccaccaacggccgagacgattttcaaccagaaaaaa
gcgggcaatcctctcgctggggccattgtggacgagtacatcggctacctgcaaacgggg
atcgacaactacgtaaacctatatgcccccgacatcatagtgctgggaggcggcatggcc
aagggccttacgggcgaaaccgacaggctgcacaacgcccgtttactgagcccatacaaa
gcgtataaaacccgcgtgaccatttctgacctggaagagaaggcgggcattgtgggcagt
gccctgctgtttaaacccgaacgactagcccccttacccaatgaaagctaa

DBGET integrated database retrieval system