KEGG   Fibrella aestuarina: FAES_2373Help
Entry
FAES_2373         CDS       T02429                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fae  Fibrella aestuarina
Pathway
fae00010  Glycolysis / Gluconeogenesis
fae00052  Galactose metabolism
fae00500  Starch and sucrose metabolism
fae00520  Amino sugar and nucleotide sugar metabolism
fae00521  Streptomycin biosynthesis
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01120  Microbial metabolism in diverse environments
fae01130  Biosynthesis of antibiotics
fae01200  Carbon metabolism
Module
fae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FAES_2373
   00052 Galactose metabolism
    FAES_2373
   00500 Starch and sucrose metabolism
    FAES_2373
   00520 Amino sugar and nucleotide sugar metabolism
    FAES_2373
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FAES_2373
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FAES_2373
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FAES_2373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: CCH00382
UniProt: I0K8C9
Position
2954544..2955440
Genome map
AA seq 298 aa AA seqDB search
MSQAIGIDLGGTRIKGVLIDPATGAVIHQLVTPTGDENGANWQSAVAETAQALTRQATEP
IQGIGLSAPGLPTPDNRAIACMPGRLQGLEGLDWSAYLGRPVRVLNDAHAALMAEARFGA
LAGSQHGLMLTLGTGVGGGLLLNGQLYQGFYQMAGHLGHITVNADSSQPDITNVPGSLED
AIGNVTVGRRSFGRYHSTHELVAGYQQGEPLAALVWLTSIRHLAVAIASLANAFSPEVVV
LGGGIMQADTALLTPLETFIDLFEWRPAGKKTIIRKAHFDDWSGAIGAAAFLPHEQTI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcaggcaataggcatcgatttaggcggaacccggatcaaaggtgtcctgatcgac
ccggctacgggcgcggtcatccatcaattggttaccccaaccggtgacgaaaatggggca
aactggcagtcggccgtcgccgaaaccgcacaggcgctgacccgccaggcaaccgagcct
attcagggcattggcctgtcggcaccgggcctgcccacgcccgacaaccgggccattgcc
tgcatgccgggtcgccttcaggggctggaagggctcgactggtcggcctatctgggtagg
cccgtccgggtactcaacgatgcccacgccgccctgatggccgaagcccgctttggggca
ctggcaggcagtcagcacgggctgatgctgaccctcggaacgggcgtcgggggcgggcta
ctactcaacggacagctctaccagggtttctaccagatggcggggcatctgggccacatc
accgtcaacgccgatagcagccaacccgacattaccaacgtacccggcagtctggaagat
gccatcggcaacgtgacggttggcagacgctcgtttggccgctaccacagcacccacgag
ctggtggccgggtatcagcagggcgaaccgctggcagcactcgtctggctgacgtccatt
cgccatctggccgtagcaattgcctcactggccaatgcgttttcgcccgaagtggtggta
ctgggcggcggcatcatgcaggccgacacggccctgctgacaccgctcgaaacctttata
gacttatttgaatggcgacccgccggtaaaaaaacgatcatccgaaaagcccacttcgac
gattggtccggtgccatcggtgcggctgcttttctaccccacgaacaaaccatatga

DBGET integrated database retrieval system