KEGG   Fibrella aestuarina: FAES_2373Help
Entry
FAES_2373         CDS       T02429                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fae  Fibrella aestuarina
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FAES_2373
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FAES_2373
   00052 Galactose metabolism
    FAES_2373
   00500 Starch and sucrose metabolism
    FAES_2373
   00520 Amino sugar and nucleotide sugar metabolism
    FAES_2373
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FAES_2373
   00524 Butirosin and neomycin biosynthesis
    FAES_2373
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FAES_2373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2954544..2955440
Genome map
AA seq 298 aa AA seqDB search
MSQAIGIDLGGTRIKGVLIDPATGAVIHQLVTPTGDENGANWQSAVAETAQALTRQATEP
IQGIGLSAPGLPTPDNRAIACMPGRLQGLEGLDWSAYLGRPVRVLNDAHAALMAEARFGA
LAGSQHGLMLTLGTGVGGGLLLNGQLYQGFYQMAGHLGHITVNADSSQPDITNVPGSLED
AIGNVTVGRRSFGRYHSTHELVAGYQQGEPLAALVWLTSIRHLAVAIASLANAFSPEVVV
LGGGIMQADTALLTPLETFIDLFEWRPAGKKTIIRKAHFDDWSGAIGAAAFLPHEQTI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcaggcaataggcatcgatttaggcggaacccggatcaaaggtgtcctgatcgac
ccggctacgggcgcggtcatccatcaattggttaccccaaccggtgacgaaaatggggca
aactggcagtcggccgtcgccgaaaccgcacaggcgctgacccgccaggcaaccgagcct
attcagggcattggcctgtcggcaccgggcctgcccacgcccgacaaccgggccattgcc
tgcatgccgggtcgccttcaggggctggaagggctcgactggtcggcctatctgggtagg
cccgtccgggtactcaacgatgcccacgccgccctgatggccgaagcccgctttggggca
ctggcaggcagtcagcacgggctgatgctgaccctcggaacgggcgtcgggggcgggcta
ctactcaacggacagctctaccagggtttctaccagatggcggggcatctgggccacatc
accgtcaacgccgatagcagccaacccgacattaccaacgtacccggcagtctggaagat
gccatcggcaacgtgacggttggcagacgctcgtttggccgctaccacagcacccacgag
ctggtggccgggtatcagcagggcgaaccgctggcagcactcgtctggctgacgtccatt
cgccatctggccgtagcaattgcctcactggccaatgcgttttcgcccgaagtggtggta
ctgggcggcggcatcatgcaggccgacacggccctgctgacaccgctcgaaacctttata
gacttatttgaatggcgacccgccggtaaaaaaacgatcatccgaaaagcccacttcgac
gattggtccggtgccatcggtgcggctgcttttctaccccacgaacaaaccatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system