KEGG   Fibrella aestuarina: FAES_2384Help
Entry
FAES_2384         CDS       T02429                                 

Gene name
galA3
Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
fae  Fibrella aestuarina
Pathway
fae00052  Galactose metabolism
fae00561  Glycerolipid metabolism
fae00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FAES_2384 (galA3)
  Lipid metabolism
   00561 Glycerolipid metabolism
    FAES_2384 (galA3)
   00600 Sphingolipid metabolism
    FAES_2384 (galA3)
Enzymes [BR:fae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     FAES_2384 (galA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36C Melibiase_2 Glyco_hydro_36N GHL6
Motif
Other DBs
NCBI-ProteinID: CCH00393
UniProt: I0K8E0
Position
2967388..2969541
Genome map
AA seq 717 aa AA seqDB search
MQTRFRFVFLPCLVFLLMLATTGWSHPPGHSTNPPFATWTATELRLSNGLVERIIKLPTA
SSGTFLTTTYKPVAGEFRYFTKTNADFRFELNDRVYTGSDNWKLITIRPSTDARQGDGAA
VTLRSQDGSAEVTLQFLLYPDQPVIRKSLTVKNLSSEPVRLESVDVEKFTVTPYYATTFS
WICHDYGRRRSIGPYDGNFQDALLTVHNSDWAQGIVVGNEAAGVVKHTSVFWDEPAIISG
LTHKTARFPFRKYLKQGESFTTPQVFTIVYNNHKDPDEVLNTAVPDFVRKHMGIRLSELA
QKPTFVYNTWVPFRKDINEKLVMELAKAAADAGMKEFIIDDGWADNYGDWIIDKKKFPNG
LKPVFDYIKSLGMKPGLWVSVGSASPDSKVYQAHPEWFVLDDKQQPANLHEDDLKMRTAC
FGTEWRNYIKDVLLKLALDYGLEYLKLDFTVVTSTYRFGNKVTGCYATNHKGHADHHESL
SSNYEAVWQLFDELHAAKPSLFIDCTFETMGGLQLIDYALLKHAEGDWLSNFYGPPDANV
DLRVRNMAWWRSPAIPATALVIGNPEMQDAGWEMHIKSLAGALPIMLGDPRKLSPADLKK
YRAYADWLQAMENRHQIMTYRQDLPGFGEPKEGLWDGFQRINTDTKKGGIVGVFRHNAPE
ANRLVTVQQLDPAKRYQVRDMAGRVVTTMTGQALHETGFPVTLPGPYGGALYEIIAQ
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgcagacccgtttccgcttcgtatttctgccttgtctagttttcctgttgatgttggcg
acaacgggctggtcgcacccgccgggccactcgaccaacccgccgtttgccacctggacg
gctacggaactgcggctgagcaacgggcttgtggagcgaatcatcaaactccctacggca
tcgtcaggtacgttcctgaccaccacctacaagccggtagcgggcgagttcaggtacttc
accaaaacgaacgccgatttccggtttgaactcaacgaccgagtctacacgggttccgac
aactggaaactgatcaccattcggccgagcaccgatgcccggcagggcgacggggccgcc
gtaacgctacgaagccaggacggtagcgctgaggtcacgctccagtttttgctttacccg
gaccagcccgtcattcgtaaaagcctgacggtgaagaacctgagcagcgagccggttcgc
ctcgaatccgttgacgtagagaagtttacggtaacgccctattacgccaccacgtttagc
tggatctgtcacgattacggccgccgccggtcgattggcccgtacgatggtaacttccag
gacgccctgctgacggtgcataacagcgattgggcgcagggcatcgtggtgggcaacgag
gccgccggggtggtcaaacatacgtcggtgttctgggatgaacccgccattatcagtggc
ctgacgcacaaaacagcccgcttcccgtttcggaaatacctcaaacaaggcgagtcattc
actacgccgcaggtcttcacgatcgtctacaacaaccacaaagacccggacgaggtgctg
aatacggccgtgcccgattttgtgcgcaaacacatgggcattcggctgtcggagctggcg
cagaagcccacctttgtctacaatacctgggtgccgttccgcaaggacatcaacgagaaa
ctggtgatggagctggccaaagccgccgccgacgccgggatgaaggagttcatcatcgat
gatgggtgggccgacaattacggcgactggatcatcgacaaaaagaagtttcccaacggc
ctgaaacccgttttcgactacatcaaatcgctggggatgaagcccggcctctgggtcagc
gtgggcagcgcgtcgcccgacagcaaggtgtatcaggcgcacccggagtggtttgtgctc
gacgacaagcagcaaccggccaacctgcacgaagacgacctgaagatgcgcaccgcctgc
tttggcaccgaatggcgcaattacatcaaagacgtgctgctgaaactagccctcgactac
ggcctggaatacctcaagcttgattttacggtcgtgacgagtacgtaccgatttggcaat
aaagtaaccggctgctacgcgaccaaccacaaaggacacgccgaccaccacgagtcgttg
tcgagcaattacgaggctgtctggcaactgttcgacgaactgcacgccgccaagccttcc
ctgtttatcgactgcacgtttgagacgatgggcggcctgcaactgatcgactacgcctta
ctcaaacatgccgagggcgactggctctcgaatttctacggcccgcccgacgccaacgta
gacctgcgcgtgcggaacatggcctggtggcgctcgcccgccatacccgccacggccctg
gtgatcggtaaccccgagatgcaggatgccggctgggaaatgcacatcaaatcgctggcc
ggtgcgctgccgatcatgctgggtgacccccgaaaactgtcgcccgctgacctgaaaaaa
taccgcgcctacgccgactggctacaggcgatggaaaacaggcatcagatcatgacctac
cggcaggatctgcccggtttcggcgagccgaaagagggtctgtgggacggctttcagcgc
atcaacactgacacgaaaaaaggcggcatcgtcggcgttttccggcacaacgccccggag
gccaaccgcctggtgacggtgcagcaactcgacccggccaaacgctatcaggtcagggat
atggctggccgcgtcgtgacgacgatgaccggtcaggcccttcacgaaaccggtttcccc
gttacgttgcccggcccatacggcggagccctttatgagatcattgcccaataa

DBGET integrated database retrieval system