KEGG   Fibrella aestuarina: FAES_2384Help
Entry
FAES_2384         CDS       T02429                                 

Gene name
galA3
Definition
glycoside hydrolase clan GH-D (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fae  Fibrella aestuarina
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fae00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fae00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fae00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2967388..2969541
Genome map
AA seq 717 aa AA seqDB search
MQTRFRFVFLPCLVFLLMLATTGWSHPPGHSTNPPFATWTATELRLSNGLVERIIKLPTA
SSGTFLTTTYKPVAGEFRYFTKTNADFRFELNDRVYTGSDNWKLITIRPSTDARQGDGAA
VTLRSQDGSAEVTLQFLLYPDQPVIRKSLTVKNLSSEPVRLESVDVEKFTVTPYYATTFS
WICHDYGRRRSIGPYDGNFQDALLTVHNSDWAQGIVVGNEAAGVVKHTSVFWDEPAIISG
LTHKTARFPFRKYLKQGESFTTPQVFTIVYNNHKDPDEVLNTAVPDFVRKHMGIRLSELA
QKPTFVYNTWVPFRKDINEKLVMELAKAAADAGMKEFIIDDGWADNYGDWIIDKKKFPNG
LKPVFDYIKSLGMKPGLWVSVGSASPDSKVYQAHPEWFVLDDKQQPANLHEDDLKMRTAC
FGTEWRNYIKDVLLKLALDYGLEYLKLDFTVVTSTYRFGNKVTGCYATNHKGHADHHESL
SSNYEAVWQLFDELHAAKPSLFIDCTFETMGGLQLIDYALLKHAEGDWLSNFYGPPDANV
DLRVRNMAWWRSPAIPATALVIGNPEMQDAGWEMHIKSLAGALPIMLGDPRKLSPADLKK
YRAYADWLQAMENRHQIMTYRQDLPGFGEPKEGLWDGFQRINTDTKKGGIVGVFRHNAPE
ANRLVTVQQLDPAKRYQVRDMAGRVVTTMTGQALHETGFPVTLPGPYGGALYEIIAQ
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgcagacccgtttccgcttcgtatttctgccttgtctagttttcctgttgatgttggcg
acaacgggctggtcgcacccgccgggccactcgaccaacccgccgtttgccacctggacg
gctacggaactgcggctgagcaacgggcttgtggagcgaatcatcaaactccctacggca
tcgtcaggtacgttcctgaccaccacctacaagccggtagcgggcgagttcaggtacttc
accaaaacgaacgccgatttccggtttgaactcaacgaccgagtctacacgggttccgac
aactggaaactgatcaccattcggccgagcaccgatgcccggcagggcgacggggccgcc
gtaacgctacgaagccaggacggtagcgctgaggtcacgctccagtttttgctttacccg
gaccagcccgtcattcgtaaaagcctgacggtgaagaacctgagcagcgagccggttcgc
ctcgaatccgttgacgtagagaagtttacggtaacgccctattacgccaccacgtttagc
tggatctgtcacgattacggccgccgccggtcgattggcccgtacgatggtaacttccag
gacgccctgctgacggtgcataacagcgattgggcgcagggcatcgtggtgggcaacgag
gccgccggggtggtcaaacatacgtcggtgttctgggatgaacccgccattatcagtggc
ctgacgcacaaaacagcccgcttcccgtttcggaaatacctcaaacaaggcgagtcattc
actacgccgcaggtcttcacgatcgtctacaacaaccacaaagacccggacgaggtgctg
aatacggccgtgcccgattttgtgcgcaaacacatgggcattcggctgtcggagctggcg
cagaagcccacctttgtctacaatacctgggtgccgttccgcaaggacatcaacgagaaa
ctggtgatggagctggccaaagccgccgccgacgccgggatgaaggagttcatcatcgat
gatgggtgggccgacaattacggcgactggatcatcgacaaaaagaagtttcccaacggc
ctgaaacccgttttcgactacatcaaatcgctggggatgaagcccggcctctgggtcagc
gtgggcagcgcgtcgcccgacagcaaggtgtatcaggcgcacccggagtggtttgtgctc
gacgacaagcagcaaccggccaacctgcacgaagacgacctgaagatgcgcaccgcctgc
tttggcaccgaatggcgcaattacatcaaagacgtgctgctgaaactagccctcgactac
ggcctggaatacctcaagcttgattttacggtcgtgacgagtacgtaccgatttggcaat
aaagtaaccggctgctacgcgaccaaccacaaaggacacgccgaccaccacgagtcgttg
tcgagcaattacgaggctgtctggcaactgttcgacgaactgcacgccgccaagccttcc
ctgtttatcgactgcacgtttgagacgatgggcggcctgcaactgatcgactacgcctta
ctcaaacatgccgagggcgactggctctcgaatttctacggcccgcccgacgccaacgta
gacctgcgcgtgcggaacatggcctggtggcgctcgcccgccatacccgccacggccctg
gtgatcggtaaccccgagatgcaggatgccggctgggaaatgcacatcaaatcgctggcc
ggtgcgctgccgatcatgctgggtgacccccgaaaactgtcgcccgctgacctgaaaaaa
taccgcgcctacgccgactggctacaggcgatggaaaacaggcatcagatcatgacctac
cggcaggatctgcccggtttcggcgagccgaaagagggtctgtgggacggctttcagcgc
atcaacactgacacgaaaaaaggcggcatcgtcggcgttttccggcacaacgccccggag
gccaaccgcctggtgacggtgcagcaactcgacccggccaaacgctatcaggtcagggat
atggctggccgcgtcgtgacgacgatgaccggtcaggcccttcacgaaaccggtttcccc
gttacgttgcccggcccatacggcggagccctttatgagatcattgcccaataa

DBGET integrated database retrieval system