KEGG   Fibrella aestuarina: FAES_2393Help
Entry
FAES_2393         CDS       T02429                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fae  Fibrella aestuarina
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FAES_2393
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FAES_2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2979435..2980409
Genome map
AA seq 324 aa AA seqDB search
MPASVCVIGSSNTDMVIKAEKLPAPGETVIGGTFLMNPGGKGANQAVAAARLATAGVSAG
TFTPPTSVTFVANVGNDVFGRQALQQFEREGIQGDFITTDADEPSGVALIGVDSRGENCI
MVASGANARLGREQVSVALTSITDTDNTVVLLQLETPIATVDHAVRESHARGMRVVLNPA
PAQGLDPAMLACVYVITPNETEAELLTGIRVTDEVTAQQAAQHLHEAGVPKVVITLGSRG
AYISDSTGDLAPVLVAAPPVTAVDTTAAGDCFNGALAVALAEGRSLVDAVSFACKAASIS
VTRMGAQASLPHRHEVDTLPLLTV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcttctgtttgtgtaatcggtagttcaaacaccgatatggtcatcaaggccgaa
aaactacctgctcccggcgaaacggttattgggggtacattcctaatgaaccccggcggg
aaaggggccaatcaggccgttgccgccgcccgtctggcaacggcgggggtatcggccggt
acgttcacgccgcctacgtccgtcacgtttgtcgccaatgtgggcaacgacgtgtttggt
cggcaggcgcttcaacagtttgagcgggaaggtattcagggtgacttcatcacgaccgat
gccgacgagccgtcgggcgtggcgctgatcggcgtcgatagccggggcgaaaactgcatc
atggtcgcatcgggggccaacgcccgactgggccgggagcaggtatcggtggcgctaact
tcgatcacggatacggataacactgtcgttttgcttcagctcgaaacgcccatcgcaact
gtcgatcacgcggtgcgcgagagtcacgcacggggtatgcgcgtggtgctcaatcccgct
ccggcacaggggctcgaccctgccatgctggcctgtgtgtatgtgatcacgcccaacgaa
accgaagccgagctgcttaccggtatccgcgtcaccgacgaagtaaccgcccaacaggcc
gcccagcacctgcacgaagcgggcgtgccgaaggtggtgatcacactcggctcacgcggt
gcttacatctccgattcgacgggcgacctggccccggtgctggtggctgccccacccgtg
acggccgtggatacaacggcggctggcgactgcttcaacggggcgctggccgtagccctg
gccgaagggcgcagcctggtcgacgccgtatcgtttgcctgcaaagccgcgtcgatctcc
gtcacccgcatgggggctcaggcctcactaccgcaccgacacgaagttgatactctgcct
ttactgaccgtttaa

DBGET integrated database retrieval system