KEGG   Fibrella aestuarina: FAES_2513Help
Entry
FAES_2513         CDS       T02429                                 

Definition
acyl-CoA thioesterase I (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
fae  Fibrella aestuarina
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FAES_2513
Enzymes [BR:fae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     FAES_2513
   3.1.2  Thioester hydrolases
    3.1.2.-  
     FAES_2513
Lipid biosynthesis proteins [BR:fae01004]
 Fatty acid synthase
  Component type
   FAES_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3115593..3116303
Genome map
AA seq 236 aa AA seqDB search
MQVITRVTALLLLAGFLSCQTKTDTATQTTTATDSTGTTASTASTKKVIVFFGNSLAAGY
GLDNTADAFPNRIGARIDSLGLPYRVVNAGLSGETTAGGRSRVGWILRQAGRGTAVDVFV
LELGGNDGLRGIPLKSSRENLQAIIDTVRLQNPQARVVIAGMQIPPNLGRTYTTEFRELF
KELATKNKAVLIPFLLEGVGGNPKLNQPDGIHPNVQGHRIVAETVWQVIGPMLQAS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcattacccgcgttacggcgctactcctgctggctggctttttgagctgccag
accaaaaccgatacggctacccaaaccaccacggccaccgattctacggggaccaccgcc
tcaacggcttcgaccaaaaaagtaattgttttcttcgggaacagcctggctgccgggtat
ggcctcgacaacaccgccgacgccttcccgaaccggattggcgcgcggatcgactcgttg
ggcttgccctaccgggtggtcaacgccggactaagcggcgaaaccaccgccggtggccgt
agccgcgtaggctggattctgcggcaggccggacgtggcaccgccgtcgacgttttcgtg
ctcgaactgggcggcaacgatggcctgcgcggcattccgctcaagtcgtcgcgggagaac
ttgcaggccattatcgataccgtccggctacaaaacccgcaggcccgggtcgtgattgcc
gggatgcagattccgcccaacctgggccgtacctacaccaccgaattccgcgagctgttc
aaagagctggcgaccaaaaacaaggccgtgctgattccctttctgctcgaaggagtgggc
ggtaaccccaaactgaatcagcccgatggtattcaccccaacgtacagggccaccgcatc
gtggctgaaaccgtctggcaggtgattggccccatgctccaggcgagctaa

DBGET integrated database retrieval system