KEGG   Fibrella aestuarina: FAES_2615Help
Entry
FAES_2615         CDS       T02429                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fae  Fibrella aestuarina
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FAES_2615
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FAES_2615
Enzymes [BR:fae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FAES_2615
Lipid biosynthesis proteins [BR:fae01004]
 Desaturase
  First
   FAES_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3243727..3244518
Genome map
AA seq 263 aa AA seqDB search
MIVVAAFAAHWYLSLFCQTFFLHRYSAHKMFSMSKFWERFFYALTYVSQGSSYLSPRAYA
VLHRMHHAFSDTPKDPHSPHHTKNIFTMMWQTKNIYNAVLHRKQAIERQFDRNYPEWNLM
EKIGDSWVSRAGWGIAYSLFYVFAFIYLDMHWAFFFLLPVHFVMGPVHGAIINWSGHKYG
YANFDNHDKSKNSLVLDVVMMGELFQNNHHKRPNAANFGAKWFEFDPTYPMIKMLSALRI
IKMRPAKATAEFETGHERRVEVQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttgtagctgcttttgccgcacactggtatctgtctctgttctgccagaccttc
tttttgcaccgttactcggcgcataagatgttctcgatgagcaagttctgggagcggttt
ttctacgccctcacctatgtgtcgcagggctcttcgtatttaagtccccgtgcctacgcc
gtgttgcaccggatgcaccacgccttcagcgacacaccgaaagacccgcactcgccgcac
cataccaagaacatcttcacgatgatgtggcagacgaaaaacatttacaatgccgttttg
caccgcaagcaggccatcgaacggcagtttgaccgcaattaccccgagtggaacctgatg
gaaaagatcggtgattcgtgggtatcacgggccggttggggcattgcctatagcctgttc
tacgtctttgcgttcatctacctggacatgcactgggcgtttttcttcctgctgccggta
cacttcgtgatgggtcccgttcacggtgccatcatcaactggagtggccacaagtatggg
tatgccaactttgataaccacgacaagtcgaaaaactcgctggtgctcgacgtggtgatg
atgggcgaactgttccagaacaaccaccacaaacggcccaacgccgccaacttcggtgcc
aaatggtttgagttcgaccccacgtatccgatgatcaaaatgctgtcggccctgcgcatc
atcaaaatgcgccccgccaaagcgaccgccgaatttgaaactggtcacgagcgccgcgtg
gaggtacaatag

DBGET integrated database retrieval system