KEGG   Fibrella aestuarina: FAES_2615Help
Entry
FAES_2615         CDS       T02429                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fae  Fibrella aestuarina
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fae01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:fae01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3243727..3244518
Genome map
AA seq 263 aa AA seqDB search
MIVVAAFAAHWYLSLFCQTFFLHRYSAHKMFSMSKFWERFFYALTYVSQGSSYLSPRAYA
VLHRMHHAFSDTPKDPHSPHHTKNIFTMMWQTKNIYNAVLHRKQAIERQFDRNYPEWNLM
EKIGDSWVSRAGWGIAYSLFYVFAFIYLDMHWAFFFLLPVHFVMGPVHGAIINWSGHKYG
YANFDNHDKSKNSLVLDVVMMGELFQNNHHKRPNAANFGAKWFEFDPTYPMIKMLSALRI
IKMRPAKATAEFETGHERRVEVQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttgtagctgcttttgccgcacactggtatctgtctctgttctgccagaccttc
tttttgcaccgttactcggcgcataagatgttctcgatgagcaagttctgggagcggttt
ttctacgccctcacctatgtgtcgcagggctcttcgtatttaagtccccgtgcctacgcc
gtgttgcaccggatgcaccacgccttcagcgacacaccgaaagacccgcactcgccgcac
cataccaagaacatcttcacgatgatgtggcagacgaaaaacatttacaatgccgttttg
caccgcaagcaggccatcgaacggcagtttgaccgcaattaccccgagtggaacctgatg
gaaaagatcggtgattcgtgggtatcacgggccggttggggcattgcctatagcctgttc
tacgtctttgcgttcatctacctggacatgcactgggcgtttttcttcctgctgccggta
cacttcgtgatgggtcccgttcacggtgccatcatcaactggagtggccacaagtatggg
tatgccaactttgataaccacgacaagtcgaaaaactcgctggtgctcgacgtggtgatg
atgggcgaactgttccagaacaaccaccacaaacggcccaacgccgccaacttcggtgcc
aaatggtttgagttcgaccccacgtatccgatgatcaaaatgctgtcggccctgcgcatc
atcaaaatgcgccccgccaaagcgaccgccgaatttgaaactggtcacgagcgccgcgtg
gaggtacaatag

DBGET integrated database retrieval system