KEGG   Fibrella aestuarina: FAES_2718Help
Entry
FAES_2718         CDS       T02429                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fae  Fibrella aestuarina
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FAES_2718
DNA repair and recombination proteins [BR:fae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FAES_2718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3374674..3375291
Genome map
AA seq 205 aa AA seqDB search
MEFPSKLIEDAVTEVSKLPGIGKKTALRLVLHLLKRDEDQTQTLAQALVAARTKVQYCRK
CHNLSDDTLCSICANPRRDGSTICVVEDTRDVLAIENTAQYKGLYHVLGGIISPVEGVGP
SDLHIDSLLQRLTQQNEGDEPVKEIILALSPTMEGDTTAFYLQKKLRPFSLRVSTIARGI
PIGGDLEYADEITLGRSIVSRIAYE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggagtttccctcgaagcttattgaagatgcggtgacggaggtgtcgaagctgccgggc
attggtaaaaagaccgccctgcggctggtgttacacctgctgaaacgcgacgaagaccaa
acccagacgttggcgcaggcgctggtggcggcccgcacgaaagtgcaatactgccgcaaa
tgccacaacctctccgacgacacgctctgctcgatctgcgccaatccacgccgcgacggc
tccacgatctgcgtggtggaagacacccgcgacgtgctggcgatcgaaaatacggcccaa
tacaaagggctctaccacgtgctgggtggcatcatctcgcccgtggaaggcgttggcccc
agcgatctgcacatcgactcgctgttgcagcgcctgacccagcaaaacgaaggcgacgag
cccgtcaaagagattatcctggcgctcagccccacgatggaaggcgacaccacggcgttc
tatctccagaaaaaactacggcccttcagcctgcgcgtatcgaccattgcccggggtatt
cccatcggtggtgacctcgaatatgccgacgaaatcacgcttgggcgcagcattgtgagc
cgcatagcctacgaatag

DBGET integrated database retrieval system