KEGG   Fibrella aestuarina: FAES_2920Help
Entry
FAES_2920         CDS       T02429                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fae  Fibrella aestuarina
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fae00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3631025..3631792
Genome map
AA seq 255 aa AA seqDB search
MKPNGTSLNTPSNGAASNGIHLNGHKNGHATHGLSDELVDEMGDNHALANLETPLRPDAF
DLDDDLKIDLIEAHFREIMTILGLDLTDDSLKGTPRRVAKMYVNETFKGLNPANKPSTTL
FDNKYQYNQMLVERDITVQSYCEHHFVPIIGKAHVAYISSGKVIGLSKLNRIVQYYAKRP
QVQERLTMQIADELKRALQTDDVAVIIDAAHLCVSTRGVNDTASSTLTAAYSGKFEDEAT
KQEFLKYVGMAKPTM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaacggaacttcgttgaataccccgtctaatggtgccgcttccaacggcatc
caccttaacggccacaaaaacggccatgctacccacggtttgtcggacgaactggttgac
gaaatgggggataatcacgccctggccaatctggaaacgcctttacgcccagacgctttc
gatctggacgacgacctgaaaatcgatctgattgaagcccattttcgcgaaatcatgacc
attctgggcctcgacctgacggacgacagcctgaaaggaacgccgcgccgggtggctaaa
atgtacgtcaacgagacgttcaagggcctcaaccccgccaacaaacccagcacgacgctc
ttcgacaataagtaccagtataaccagatgctggtggagcgcgacattacggtgcagtcg
tattgcgagcaccatttcgtgcccattattggaaaagcacacgtggcgtatatcagtagc
ggtaaggtaatcggcctgtcgaaactgaaccggattgtgcagtattacgccaaacgcccg
caggtgcaggaacgcctgacaatgcagattgccgacgaactgaagcgggcgctgcaaacc
gacgacgtggccgtcattatcgacgcggcccacctgtgtgtatcgacccgcggggtcaat
gacacggcttcgtcgacgctgacggctgcctacagtggcaagttcgaggacgaagccacg
aaacaggagtttttgaaatacgtaggcatggccaagccaacaatgtaa

DBGET integrated database retrieval system