KEGG   Fibrella aestuarina: FAES_2920Help
Entry
FAES_2920         CDS       T02429                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fae  Fibrella aestuarina
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FAES_2920
Enzymes [BR:fae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FAES_2920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3631025..3631792
Genome map
AA seq 255 aa AA seqDB search
MKPNGTSLNTPSNGAASNGIHLNGHKNGHATHGLSDELVDEMGDNHALANLETPLRPDAF
DLDDDLKIDLIEAHFREIMTILGLDLTDDSLKGTPRRVAKMYVNETFKGLNPANKPSTTL
FDNKYQYNQMLVERDITVQSYCEHHFVPIIGKAHVAYISSGKVIGLSKLNRIVQYYAKRP
QVQERLTMQIADELKRALQTDDVAVIIDAAHLCVSTRGVNDTASSTLTAAYSGKFEDEAT
KQEFLKYVGMAKPTM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaacggaacttcgttgaataccccgtctaatggtgccgcttccaacggcatc
caccttaacggccacaaaaacggccatgctacccacggtttgtcggacgaactggttgac
gaaatgggggataatcacgccctggccaatctggaaacgcctttacgcccagacgctttc
gatctggacgacgacctgaaaatcgatctgattgaagcccattttcgcgaaatcatgacc
attctgggcctcgacctgacggacgacagcctgaaaggaacgccgcgccgggtggctaaa
atgtacgtcaacgagacgttcaagggcctcaaccccgccaacaaacccagcacgacgctc
ttcgacaataagtaccagtataaccagatgctggtggagcgcgacattacggtgcagtcg
tattgcgagcaccatttcgtgcccattattggaaaagcacacgtggcgtatatcagtagc
ggtaaggtaatcggcctgtcgaaactgaaccggattgtgcagtattacgccaaacgcccg
caggtgcaggaacgcctgacaatgcagattgccgacgaactgaagcgggcgctgcaaacc
gacgacgtggccgtcattatcgacgcggcccacctgtgtgtatcgacccgcggggtcaat
gacacggcttcgtcgacgctgacggctgcctacagtggcaagttcgaggacgaagccacg
aaacaggagtttttgaaatacgtaggcatggccaagccaacaatgtaa

DBGET integrated database retrieval system