KEGG   Fibrella aestuarina: FAES_3487Help
Entry
FAES_3487         CDS       T02429                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
fae  Fibrella aestuarina
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FAES_3487
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FAES_3487
Enzymes [BR:fae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FAES_3487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4313644..4315530)
Genome map
AA seq 628 aa AA seqDB search
MRFLFLVGLLVASLAQAQIQLVPQPVSVQPQPGHFTLTKATTITYTKPESASVAAMLSRQ
LAEQTSLTLTSRPAAAAPVNTILLTLTPTPDAKLGREGYRLSSSPKGVVITANQPAGLFY
GTQTLLQLVPTEQPAPTGRMTQPTNVPAVQIIDYPRFGWRGVMLDVSRHFFPKADVMRYI
DELARLKLNTFHWHLTDDNGWRIEIKSLPRLTSVGAWRVPRDGHFGERPNPKPGEAATYG
GFYTQDDIREVVKYAQARNITIVPEIDIPGHSMAMLAAYPNLSCSKDTSVRVNPGTQFAE
WYGNGTFKMLIDNTLNPSDEAVYATLDKVFTEVAALFPGPYIHAGGDECYKGYWEKDPGC
QALMQKEGMKHVEQLQGYFMKRVEKIINAKGKKFLGWDEILEGDVSPSATVMSWRGMKGG
IEAAQHGHDVVMTPSTFAYIDYMQGDPTLEPRIYASLRLKTCYEFEPVPPGIDSTRILGG
QGNLWTEQIPTLAHAEYMTYPRTWALSEVFWTPRNRRDWAGFIPRLEAQMRRADAAGVNY
ARAAYDPIVSTTIADNKLTLMLDAELPGTDIFYSLDDTVPGRYSQRYSQPIPVPEGDVTL
RAVTYRNGQPAGRMLTLKRDELLKRAKK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttcttttcctcgtgggtctgctcgttgcctcactggctcaggcccagattcag
ttagtaccgcagccggtatcggtgcagcctcagccgggccacttcaccctgaccaaagcc
acaaccatcacctacaccaagccagagtcggcctcggtagcggcaatgctctcccggcaa
ctggccgaacagacaagcctcacgctgacaagccggcccgcagcggcagcccccgtcaat
accattctgctcacgctgaccccaacgcccgacgctaaactaggccgcgaaggctaccgg
ctcagtagcagtcccaagggcgttgtcatcacggccaaccaacccgccgggctgttttac
gggacgcagacgctgttgcaactggtaccgaccgaacagcctgccccgactgggcgaatg
acccagccgaccaacgtacccgccgtgcagatcatagactatccgcgctttggctggcgc
ggggtgatgctcgacgtgagccgccatttcttcccgaaagccgatgtgatgcgctacatc
gacgaactggcccgcctcaaactgaacacctttcactggcacctgaccgacgacaacggc
tggcggatcgagatcaaaagcctgccccggctcaccagcgtaggcgcctggcgtgtgccg
cgcgatgggcatttcggcgagcgacccaaccccaaaccgggcgaggccgctacgtatggc
ggcttctacacgcaggacgacatcagggaggtggtgaagtacgcgcaggcccgcaacatc
accatcgtacccgagatcgatattcccggccacagcatggcgatgctggcggcgtacccc
aacctctcgtgcagcaaagacacgtcggtgcgggtcaaccccggtacgcagtttgccgag
tggtacggcaacggcacgttcaagatgctgatcgacaatacgttgaatccgtcggatgaa
gccgtttatgctacgctcgacaaggtgttcaccgaagtggcggcgctctttccgggcccc
tacatccacgccggtggcgatgagtgctacaaagggtattgggaaaaagaccccggctgt
caggcgctgatgcagaaagaaggcatgaagcacgtggagcagcttcagggctatttcatg
aagcgggtcgagaagatcatcaacgccaaaggcaagaaattcctgggctgggacgagatt
ctggaaggcgacgtgtcgcccagcgcgaccgtgatgagctggcggggcatgaaaggcggc
atcgaagcggcccaacacggtcacgacgtggtgatgacgcccagcacctttgcctacatc
gattacatgcagggtgaccccacacttgaaccccgcatctacgccagcctgcgcctcaaa
acctgctacgagtttgaacccgtaccgcccggcatcgattcgacgcgcatcctgggtggg
caggggaacctctggaccgaacagattccgacgctggcccatgccgaatacatgacgtac
ccacgtacctgggcgctgtcggaggtattctggacgccacgcaaccgccgcgattgggcc
gggttcattccccgtctcgaagcgcagatgcgccgcgccgatgccgccggggtcaactac
gcccgcgcggcctacgatcccatcgtcagcacgaccattgctgacaataaactgaccctg
atgctcgacgccgaactgcccggcaccgatattttttactcgctcgacgacaccgtgccc
ggccgttacagccaacgctacagtcagcctattccggtgccggagggcgacgtgaccctg
cgcgccgttacctaccgcaacgggcaacccgccggccgcatgcttacgctgaagcgcgac
gagctgctgaagcgggctaaaaaatga

DBGET integrated database retrieval system