KEGG   Fibrella aestuarina: FAES_3713Help
Entry
FAES_3713         CDS       T02429                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fae  Fibrella aestuarina
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fae00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:fae00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:fae02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4594927..4596795
Genome map
AA seq 622 aa AA seqDB search
MIRFPITVRRSWLIALTGLIGYSAGLAQPVGRYTTAQAHSHNDYEQNIPFWTAYYARFGS
IEADVHAQQGKLYVAHDASAIDSSRTLDNLYIQPILQKIREHKGQIYEGGEPLQLLIDLK
TPAAQTLPLLVNALAAHPAVFGPNGPVQVVVSGNVPAPEQLGQYPDWLRFDGRPGVAYTP
EQLRHIGLISQSFLAFSRWNGKGLVVKKEAEALRAFVAQGHRLGKRVRLWATPDNINTWK
ALINLGVDYINTDQIGPLAAFLNTRSTADYVQPAPHPLYQPTYRNNDARSRVRNVILLIG
DGMGLAQIYAGLTANRGQLNLSRMLNIGFSKTSAADTYITDSAAGATAMATGQKTNNRAI
GVDTLNRPLRAIPALVKPWGMKSGLISMGSVTDATPAAFFAHQPDRAFEREIAADFLANN
TDILIGGGLRHFQEQHLLDSLQRRGYRIGTQYSQLAQLKAPFVLLDDKAVVSVEAGRPQV
LTGSLQKTLAELSPNPAGFFIMAEGAQIDYGGHANKLGYVVRELLDFDEAIGAAMRFADA
DGQTLVVVTADHETGGLTLLDGNLQKGYVDGQFSTNDHTGVMVPVFAYGPHSLDFRGVYE
NTDIFARIMAILNQYKIKPAQK
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcttcccgattacggtccgccggagctggctgatcgccctcaccgggctgatc
ggctactcggctgggctggcgcagcccgttggccgctacaccaccgcccaagcccattcg
cacaacgattacgagcaaaacatccccttctggacggcttattacgcccggtttggctcc
atcgaagccgatgtgcacgcccagcagggaaagctctacgtcgcccacgatgcctcggcc
atcgacagcagccgcaccctcgacaacctgtatattcagcccattctccagaaaatcagg
gagcacaaggggcaaatctacgaagggggcgaaccgctgcaactgctaatcgacctgaaa
accccggcggctcagacactgcccctgttggtcaacgcgctggcggcacacccggcggtg
ttcggccccaacgggcccgtgcaggtggtggtcagcggcaacgtacctgcgcccgagcag
ttgggccaataccccgactggctgcgcttcgacggccggccgggcgtcgcctacacgccc
gagcaactccggcacatcggcctcatcagccagtcgtttctggccttcagccgctggaac
gggaaaggcctcgtcgttaaaaaagaagccgaggcgctgcgggcgttcgtcgcgcagggg
catcggttgggcaaaagggttcggctttgggctacgcccgacaacattaatacctggaaa
gcgctcatcaacctgggtgtcgattacatcaataccgaccagattgggccactcgcggcc
ttcctcaatacccggtcgacggcggactatgtacagccggccccgcacccgctctaccag
ccgacgtaccgcaacaacgacgcccgcagccgggtccgcaacgtgattctgctgattggc
gacggcatggggctggcccagatttacgcgggcctcaccgccaaccggggtcagctcaac
ctgagccggatgctcaacatcggtttctcgaaaaccagcgcggccgacacttacatcacc
gattcggcggcaggtgcaacggccatggcgacggggcaaaaaaccaataaccgcgccatc
ggtgtcgacacgctgaaccgcccgctgcgggccataccggcgctggtgaagccgtggggc
atgaaaagcgggctgatctcgatgggtagcgtgaccgatgccaccccggcggcgttcttc
gcacaccagcccgaccgcgccttcgagcgggaaatcgccgccgattttctggccaacaac
accgacatactcattgggggtgggttacgtcattttcaggagcagcacctgctcgattcg
ctgcaacggcggggctaccgcatcggcacccagtatagtcagctggcgcagttgaaagcg
cccttcgtgctactcgacgataaagccgtagtatcggtcgaggctggccggccgcaggtg
ctgactggcagcctgcaaaaaacgctggccgaattaagccccaacccggccggttttttt
atcatggccgaaggcgcccagatcgactatggcggtcacgccaacaagctcgggtacgtg
gtgcgcgaactgctcgattttgacgaagccattggcgcggcaatgcgcttcgccgacgcc
gacgggcaaacgctggtggtcgtgacggccgaccacgaaaccggcggcctgaccttgctg
gatggcaacctgcaaaagggctacgtcgacgggcaattcagcaccaacgaccataccggc
gtgatggtgcccgtttttgcctacggcccgcactcgctggattttcggggtgtctacgaa
aacaccgacatctttgcccggatcatggccattctcaaccaatacaagataaagcccgct
cagaaatag

DBGET integrated database retrieval system