KEGG   Fibrella aestuarina: FAES_4347Help
Entry
FAES_4347         CDS       T02429                                 

Definition
glycoside hydrolase family 9
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fae  Fibrella aestuarina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FAES_4347
Enzymes [BR:fae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     FAES_4347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5363994..5365835
Genome map
AA seq 613 aa AA seqDB search
MHLTLPALRLRFLLGGLFFVAQTQAQSVSESIRLNQIGFYPNAAKVAIIVAGSDANGSDA
NRPDAAQPFQLTTPDGKQVVFSGTLSAARKNVISGKLARTADFSAFKKAGTYVVNVPGLG
RSYPFSIGANVHRPVAVGALKGFYYQRMSTDLPERYAGQWHRPAGHPDNHVWIHPSAATA
TRPAGSTMASPRGWYDAGDYNKYIVNSGITMGTLLSLCEDFPDFCRTLTTNIPESNNRLP
DLLDESLWNLRWMLTMQDPDDGGVYHKLTNPKFDGMVMPDKAGSPDRTSDRYAIQKTITA
TLDFAAVMAQASRVLKPYGRELPGLADSCLTAATKAWQWAKQNPNALYDQEAMNRAFDPD
VTTGAYGDRNAGDEWIWAAAELYLTTKDDAYYTAVDLFPDAKTQLPSWAQVRPLAYYSLA
RLRNQLTARGQQDLPKVKAQLLQLADGLRQDVAKHAFQTPMGKVASDYIWGSSAVAANQG
IALIQAYRLTNDATYLNAALANLDYLLGRNAVGYSFVTGFGHKTPMHPHHRPSVADGIDA
PVPGLLSGGTNANAARQDKCPGYTTTVADEVFLDADCSYASNEIAINWNAPLVYLAAAVE
ALQQKATPIPAQP
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgacactcccggccctgcgcctccgcttccttctgggcggtcttttcttcgtg
gcgcaaacccaggcccagtcggtttccgaatcgatccggctcaaccagatcgggttttac
cccaacgcggctaaggtcgccattatcgtagccgggtcagacgccaacgggtcggacgcc
aacaggccggacgctgcccagccctttcagctgaccacgcccgacggcaagcaggtggtg
ttctcaggtacgttgagtgcggctcgcaaaaacgtcatttcgggtaaactggcacgtaca
gccgatttttcggcctttaaaaaagctgggacctacgtcgtgaacgtacctggcctgggg
cgctcttatccgttttcgattggggccaacgtgcaccgccccgtggcagtgggcgcgctc
aaagggttttattaccagcgcatgagcaccgacctgcccgaacgctacgccgggcaatgg
caccgccccgccggacaccccgacaaccacgtctggattcacccgtcggcggccacggcc
acgcgcccggcgggcagcacgatggcttcgccgcgcggctggtatgatgccggcgattac
aacaagtacatcgtcaattcgggcatcacgatgggtacgttgctgtcgctttgcgaagac
ttccccgacttctgccgcacgctgaccaccaacatccccgaaagcaacaaccgcctgccc
gacctgctcgatgaatcgctctggaacctgcgctggatgctgaccatgcaggaccccgac
gatgggggcgtataccacaaactcaccaacccgaagttcgacgggatggtgatgcccgac
aaggccggttcacccgatcggacgagcgatcgctacgccattcagaaaaccatcacggcg
acgctcgactttgcggccgtgatggcgcaggccagtcgggtgctcaaaccttatggccgc
gagctgcccggcctggccgattcgtgcctgaccgccgccaccaaagcctggcagtgggcc
aaacagaaccccaatgcgctctacgatcaggaagcgatgaaccgtgccttcgaccccgac
gtaaccacaggggcctacggcgaccgcaacgcgggcgacgagtggatctgggcggcagcc
gagctctacctgactaccaaagacgacgcgtattacaccgccgtcgacctgtttcccgac
gctaaaacccagcttccgtcgtgggcgcaggtacgtccgctggcttactattcgcttgcc
cgcctgcgtaatcaactgacggcccgcggccaacaggatctgccgaaggtgaaagcccag
cttctccagctggccgatggcctgcggcaggacgtggcgaaacacgcgtttcagacaccg
atgggaaaggtagcgagcgactacatctggggtagcagcgccgtagcggccaatcagggc
atcgccctcattcaggcgtaccggctcaccaacgacgccacgtacctgaacgccgccctc
gccaacctcgattacctgctgggccgcaatgccgtgggctactcgttcgtcacgggtttt
ggtcataaaacgcccatgcacccgcaccaccgcccatcggtcgccgacggcatcgatgcg
cccgtgccgggtttactgtcgggcggaaccaacgccaacgccgcccggcaggataaatgc
ccgggctataccaccaccgtcgccgatgaggtctttctggacgccgactgctcgtatgcc
tctaacgaaatcgccatcaactggaatgcgccgctggtgtatctggccgcggcggtcgaa
gcgcttcagcagaaagcgacacctattccagcgcagccctga

DBGET integrated database retrieval system