KEGG   Fibrella aestuarina: FAES_4365Help
Entry
FAES_4365         CDS       T02429                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
fae  Fibrella aestuarina
Pathway
fae00220  Arginine biosynthesis
fae00250  Alanine, aspartate and glutamate metabolism
fae00290  Valine, leucine and isoleucine biosynthesis
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01130  Biosynthesis of antibiotics
fae01210  2-Oxocarboxylic acid metabolism
fae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FAES_4365
   00290 Valine, leucine and isoleucine biosynthesis
    FAES_4365
   00220 Arginine biosynthesis
    FAES_4365
Enzymes [BR:fae01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     FAES_4365
    2.6.1.66  valine---pyruvate transaminase
     FAES_4365
Amino acid related enzymes [BR:fae01007]
 Aminotransferase (transaminase)
  Class I
   FAES_4365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Spherulin4
Motif
Other DBs
NCBI-ProteinID: CCH02364
UniProt: I0KE11
Position
complement(5385580..5386791)
Genome map
AA seq 403 aa AA seqDB search
MEIRKSDRLTHLKYDIRGPVYEKSLELESQGYKIISLNIGNPAAFGFDTPDEIVHDIILN
IRNAQGYADSRGLFAARKAVMHYTQNLGLPGVTIQDIYIGNGVSELILLSMQALINETDE
VLVPSPDYPLWTTSVALCGGKPVHYTCDETNGWNPDLADLESKITPKTRAVVIINPNNPT
GAVYDKAILEGIARIAEKHKLIVFADEIYDKILYDGATHNPMARFVHDTLCISMGGLSKN
YRGAGFRGGWLVITGAKHKAKSYIEGLTLLASLRLCANVPTQYAIQTALGGYQSINDLVL
PSGRLYRQIMLAYERMVAIPGISCVKPKGALYIFPRIDLTQFNIEDDNAFVYDLLVEQKV
LVVAGQGFNFKTPDHFRIVCLPTVDELTIALDRIEAFLESRRK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgcaaatctgaccgcctgacgcacctcaaatacgacattcgggggccggtc
tatgagaaatcgctggagctggagagccagggatacaagattatcagcctgaacattggt
aatccggcggcgtttggtttcgatacgcccgacgaaattgtccacgatatcatcctgaat
atccggaatgcgcagggctatgccgactcgcggggactgtttgcggcccgaaaagcggtg
atgcattacacgcaaaacctcggtttgccgggcgtcaccattcaggatatttacatcggc
aatggcgtcagtgagctgattctgctctcgatgcaggcactgatcaacgaaaccgacgaa
gtgctcgtgccctcgcccgattacccgctctggacaacctcagtggcgctttgcggtggt
aaacccgtgcattacacctgcgacgaaaccaatggctggaatcctgatctagcggatctg
gaaagcaaaatcacgccgaaaacgcgggcggtggtcattatcaatcccaacaaccccacc
ggcgccgtctacgacaaagctattctggaaggcatcgcgcgcatcgccgaaaaacacaag
ctgatcgtatttgccgatgagatctacgacaagattctgtatgacggcgccacgcataac
ccgatggcccgcttcgtccacgacacactctgcatttcgatgggcggcctgtcgaaaaat
taccgcggcgccggtttccggggtggctggctggtgataacgggggccaaacacaaagcc
aagtcgtatatcgagggcctcacgctgctggcgagtctgcggctctgcgccaacgtaccc
acgcaatacgccatccagacggcgctgggtgggtaccagagtatcaacgatctggtgtta
cccagcggccgactataccggcagatcatgctcgcctacgagcgcatggtggcgattccg
ggcatcagctgcgtgaaacccaaaggcgcgttgtacatcttcccgcgtatcgacctcacc
cagttcaacatcgaagacgataacgcctttgtgtatgatctgctggtcgagcagaaggtg
ctggtggtagcggggcagggcttcaatttcaaaacacctgaccacttccggatcgtctgc
ctgcccacggtcgatgagctaaccatcgccctcgaccgcatcgaggcctttctggaaagc
cgacggaagtaa

DBGET integrated database retrieval system