KEGG   Fibrella aestuarina: FAES_4593Help
Entry
FAES_4593         CDS       T02429                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fae  Fibrella aestuarina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FAES_4593
Enzymes [BR:fae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FAES_4593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5684510..5686018
Genome map
AA seq 502 aa AA seqDB search
MLQLRSSGLLLHITSLPSPHGVGDLGPEAYRFADFLAQSGQTYWQILPLTPLDPGAGFSP
YSSPSAFAGNTLLISFDRLVEQGLLPAEDVAVLGAEWQSSPASMATAWSKKQPLLRKAAE
TFIEQGLTTAGLGFDSFCYRQAEWLDDYALFVALQQDLNVPVWTNWPDALVRRDPDELAC
QTDRLAHEITVVKVLQYLFYQQWNDLIRYCYNRKVHLIGDIPIYVQQNSADVWGNKTLFK
LDEHGLPRYVAGSPPDYFSADGQRWGNPIYDWAEHERTGFAWWIRRLRHQMSLYSLTRLD
HFLGFDMYWEIPSTEPTAKVGTWVKAPTEAFIQAMYRQFVQLPMIAEDLGARSAEIQPLL
AHYNIPGMRVAQFGYGEDLPTSSHIVHNHTFNNVVYTGTHDNNTTLGWFRQGEPELHQRL
NDYLGTTVTEENVVALLTRQAMQSVARLAILPVQDLLNLDENHRMNTPGLGGYSWQWRLQ
PGQLTTDVSEQLLALTKMTGRL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaacttcgctcgagcggtttgctgctccatattacatcgctgccttcaccccac
ggggtaggcgatctgggccccgaggcctaccgtttcgccgattttctggctcagtcgggt
cagacctattggcaaattcttcccctaacgcccctcgaccccggtgccgggttctcgccc
tacagcagcccgtcggcctttgcgggcaatacgttgctcatcagtttcgaccggctggtt
gaacaggggctgctgcccgccgaagacgtagccgtgctaggtgccgaatggcaaagctcg
ccggcttcgatggccacggcctggagcaaaaagcagccgctgctgcgcaaagccgccgaa
accttcatcgaacagggcctgaccaccgccggtctgggcttcgattcgttttgctaccgg
caggccgagtggctcgacgactacgccctgtttgtggcccttcagcaagacctgaacgta
ccggtctggaccaattggccggatgcgctggtgcggcgcgaccccgacgaactggcctgc
caaaccgatcggctggcgcacgagattacggtggtgaaggtattgcagtacctgttttat
cagcaatggaacgacctgatccgatactgctacaatcgtaaggtccacctcatcggcgat
attcccatctacgtgcagcaaaacagcgccgacgtgtggggcaacaaaacgttgttcaaa
ctcgacgagcacgggctgcccaggtacgttgccggctcaccgcccgattatttttcggcc
gacggacaacgctgggggaaccccatttacgattgggccgagcacgaacgtacggggttt
gcctggtggatccggcggttgcggcatcagatgtcgctctacagcctcacccgcctcgat
cacttcttgggcttcgatatgtactgggaaattccgtcgacggaaccgaccgccaaggta
ggtacgtgggtgaaagcgccgaccgaggccttcattcaggccatgtaccggcaatttgtg
caattacccatgatcgcggaagatttgggtgcccggtcggcggagattcagcccctgctg
gcgcattacaacattccgggcatgcgcgtggcccagtttggctatggcgaagacctgccc
acttcgtcacacattgtgcacaatcacacgttcaacaacgtagtctacaccggcacgcac
gacaacaacacgacgctgggctggttccggcagggggagccggagttgcaccaacgcctg
aacgactacctggggactaccgtcacggaagaaaacgtggttgcgctgcttacccgtcag
gcgatgcagtcagtggcccggctggctattctgccggtgcaggatctgctgaatctggac
gaaaatcaccgcatgaacacgccgggtctgggtggctacagctggcaatggcggcttcag
cccggtcagctcactaccgacgtaagcgaacaattactggcactgaccaaaatgacgggg
agattgtaa

DBGET integrated database retrieval system