KEGG   Fibrella aestuarina: FAES_5019Help
Entry
FAES_5019         CDS       T02429                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fae  Fibrella aestuarina
Pathway
fae00020  Citrate cycle (TCA cycle)
fae00640  Propanoate metabolism
fae00660  C5-Branched dibasic acid metabolism
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01120  Microbial metabolism in diverse environments
fae01130  Biosynthesis of antibiotics
fae01200  Carbon metabolism
Module
fae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FAES_5019
   00640 Propanoate metabolism
    FAES_5019
   00660 C5-Branched dibasic acid metabolism
    FAES_5019
Enzymes [BR:fae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FAES_5019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: CCH03018
UniProt: I0KFW5
Position
complement(6192974..6194191)
Genome map
AA seq 405 aa AA seqDB search
MNIHEYQGKEILKRYGVRIQEGIVAESPEKAVEAAKQIMAQTNSKFVVVKSQIHAGGRGK
GKVKGGEQRGVALAKSVDEVRDIAKNLIGNVLVTHQTGPEGKKVNKVLVAQDVFYPGETE
PKEMYLGILLDRSKACNVIMASTEGGMDIEEVAEKTPEKIVKEWIDPAVGLQPFQARKIA
FGLGMTGEAFKEMVKFVTSLYKAYVDTDASMFEINPVLKTSDNKIMAVDAKVNIDDNALY
RHPDLASYRDVTEEDPLEVEASANDLNYVKLDGNVGCMVNGAGLAMATMDIIKLSGGEPA
NFLDVGGGANAKTVEAGFRIILKDPNVKAILINIFGGIVRCDRVATGVVEAYKAIGDIPV
PIIVRLQGTNAAEGAKIIDESGLKVQSAVELKEAAEKVRQVVAAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcagggtaaagaaatattgaagcgctacggcgttcggattcag
gaaggcatcgtggcggagtcgcccgagaaggccgttgaagcggcgaagcagatcatggct
cagacaaactcgaagtttgtggtcgtgaagtcgcaaatccacgcgggaggccgcgggaaa
ggaaaagtcaaaggcggcgagcaacgcggtgtagccctggccaaatcggtcgacgaggtg
cgcgatattgctaaaaacctgatcggcaacgtactggttacgcaccaaaccggccccgaa
ggcaagaaagtgaacaaagtgctggtcgcacaggacgtattctaccctggcgaaaccgag
ccgaaagaaatgtatctgggcattctgctcgatcgttcgaaagcctgcaacgtgatcatg
gccagcaccgaaggtggtatggacattgaagaggtagccgaaaaaacacccgagaaaatc
gtaaaagaatggatcgatccggcggttggcctgcaaccgtttcaggcccgcaaaattgcg
tttggcctgggcatgaccggcgaagccttcaaagagatggtcaaattcgtgacctcgctc
tataaagcttacgtggataccgacgcgtcgatgttcgagatcaaccccgttcttaaaacg
tcagacaataaaattatggcggtcgatgccaaagtaaacatcgacgacaacgccctgtac
cgtcaccccgatctggccagctaccgcgacgtaacggaagaagatccgctcgaagtagaa
gcgtcggccaatgacctcaactacgtgaaactcgacgggaacgtgggttgcatggtaaac
ggcgccgggctggcgatggccaccatggacatcatcaaactgtcgggtggtgagccggcc
aacttcctcgacgtagggggtggcgccaacgccaagacggtggaagcgggcttccggatc
atcctgaaagacccgaacgtgaaggccatcctgatcaacatcttcggcggtatcgttcgc
tgcgaccgcgtagctacgggcgttgtggaagcctacaaagccatcggcgacatcccggta
ccgatcattgtccggttgcagggtaccaacgcggccgaaggtgccaagatcatcgacgag
tcggggctgaaagtgcagtcggccgttgaactgaaagaagccgccgagaaagttcggcag
gtagtagcagcgctgtaa

DBGET integrated database retrieval system