KEGG   Fibrella aestuarina: FAES_5416Help
Entry
FAES_5416         CDS       T02429                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fae  Fibrella aestuarina
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    FAES_5416
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FAES_5416
Enzymes [BR:fae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     FAES_5416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6658584..6660065
Genome map
AA seq 493 aa AA seqDB search
MLLSDLVYKVSLLATAGPMSAEVTHLTMDSRRVGPGSLFIAVRGTVSDGHSFIPKAIEQG
ATAILCEELPAERPEALPESVTFVQVENAPRAMGFLAANFYGHPSKKIKLVGVTGTNGKT
SVATLLFRLFRALGYRCGLLSTVQNQIDDEVIPTTHTTPDAITTNELLVNMIKHGCTHVF
MEVSSHAVVQERIAGLHFVGGIFTNITHDHLDFHGTFDNYIKAKKGFFDQLPRSAFALTN
ADDKRGAVMLQNTLARKESYSLQSLGTFKGKVLADGLFGMEMLVDERQVWFKLIGRFNAY
NLLAVYGAAVLLGEDEEAILTELSSLTPPPGRFEQVISPDKIVGIVDYAHTPDALQNVLE
TIDSLRQSNDSGVLPQVITVVGCGGNRDAAKRPIMAQIACKLSDRVILTSDNPRFEDPMA
ILEQMQAGIPAIDYKKTRTIEDRRAAIQAAVAMARPHDIILVAGKGHETYQDIQGVKYDF
DDRLELRKAYQIR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgctgttatccgatctagtctataaagtctccctgctggctacggccggccccatgagc
gccgaggtaacccacctgacgatggattcgaggcgcgttgggccggggagcttgttcatt
gccgtgcggggtaccgtttccgatggccacagtttcatccccaaagcgattgaacagggg
gcgaccgccattctgtgcgaagaactgcctgccgagcggcccgaggccctgcccgagtcg
gtcacgtttgtgcaggtcgagaatgccccccgggcgatgggcttcctggcagccaatttc
tacgggcacccgtcgaaaaagatcaagctggtcggcgtgacgggcaccaacggcaaaacc
tcggtggctaccctgctcttccggctgttccgggcgctgggctaccgctgcggcctgctc
tcgacggtgcagaatcaaatcgacgacgaggtgattccgaccacgcacaccacgcccgat
gccatcacgaccaacgaactgctggtgaacatgatcaaacacggttgtacgcacgtgttc
atggaggtcagctcccacgcggtggtgcaggagcgcattgccgggctgcatttcgtgggg
ggcattttcaccaacatcacccacgaccacctcgattttcacggcacgttcgataactac
atcaaagccaaaaaaggctttttcgatcagttgccgcgctcggcctttgccctgaccaac
gccgacgacaaacgtggggcggtgatgttgcaaaacacgctggctcgcaaagagagctac
tcgctccagtcgctgggaacgttcaaaggcaaggtgctggccgacggcctgtttggcatg
gaaatgcttgtcgatgagcgacaggtttggttcaaactcatcggtcggttcaacgcctac
aacctgctggcggtgtatggcgcggcggtgttgctgggcgaagacgaagaggcgatcctg
accgagctatcgagcctgacgcccccgcctggccggttcgaacaggtgatttcgccggat
aaaatcgtcgggattgtcgattacgcccacacgcccgacgccctgcaaaatgtgctggaa
accatcgacagccttcggcaaagcaacgactcgggtgtactgccccaggtgattacggtg
gtgggttgcggcggcaatcgcgatgcagccaaacggcccatcatggcgcagattgcctgc
aagctcagcgatcgggtgattctgacctccgacaacccgcgctttgaagaccctatggcg
attttggagcagatgcaggcgggcataccagcgatcgattacaaaaagacgcgcacaatc
gaagaccgccgcgcggcaattcaggcagcagtagccatggcgcgcccccacgacattatc
ttggtagcgggtaaaggccacgaaacctaccaggatattcagggcgtgaaatacgatttc
gacgaccggcttgaactacgtaaagcctaccaaatccgctaa

DBGET integrated database retrieval system