KEGG   Frankia alni: FRAAL0174Help
Entry
FRAAL0174         CDS       T00384                                 

Definition
phosphoglycerate mutase 2 protein (EC:5.4.2.1)
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(172320..173051)
Genome map
AA seq 243 aa AA seqDB search
MSVGGLVAELTAVRHGQSVANVAFPAARAAGRLDAGVSGRDADVELTPLGRAQAAALGRA
LAAEPPIIRPPEVVVCSPYLRARRTYEIAAEAAARGGLALPEPVIDDRLVDRLMGRFELM
TRAAIDARFPAEAERRRASGQWDYRPPGGENFPDIARRLGALLTDLHHDHADRRVLIVAH
DAVVVMLRQLVEGLSYDELGRIAAEGGIRNAGITRFTRDGDQLTLAEFNTATHLAGVSAD
GAA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtggggggtctggtcgccgaactgacggcggtccggcacgggcagagcgtcgcg
aacgtcgcgttcccggcggcgcgggcggcgggtcggctcgacgcgggcgtgtcggggcgg
gacgccgacgtcgagctgacgccgctgggacgcgcgcaggccgccgcgctcggccgggcg
ctggccgccgagccgccgatcatccggccgcccgaggtcgtcgtctgttcgccctacctg
cgcgcccgccgcacctatgagatcgccgccgaggcggcggcccgcgggggcctggcgctg
cccgagccggtgatcgacgaccgactggtggaccggctgatgggccggttcgagctgatg
acgagggccgcgatcgacgcccgcttccccgcggaggccgagcgtcggcgcgcgtccggg
cagtgggactaccggccgccgggcggggagaacttccccgacatcgcccgccggctgggc
gcgctgctgaccgacctgcaccacgaccacgccgaccggcgggtcctcatcgtcgcgcac
gacgccgtcgtggtcatgctgcgccagctcgtcgaggggctgtcctacgacgagctgggc
cggatcgccgccgagggcggcatccgcaacgccgggatcacccgcttcacccgcgacggc
gatcagctcaccctcgccgagttcaacaccgcgacccatctcgcgggcgtcagcgcggac
ggagcggcctga

DBGET integrated database retrieval system