KEGG   Frankia alni: FRAAL0199Help
Entry
FRAAL0199         CDS       T00384                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00121  
S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Degradation of aromatic compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:fal01200]
Metabolism; Overview; Degradation of aromatic compounds [PATH:fal01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fal00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:fal00680]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:fal00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:fal00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:fal00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:fal00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(195726..196838)
Genome map
AA seq 370 aa AA seqDB search
MKTKAAVLYEAGKPFEIEELEIVKPGAEEVLVRYDYSGLCHSDLHMVKGHLPFRAPMVFG
HEGAGEILEAGSNVTGFHPGDHFVASFYPVCGRCRWCATGNSRLCDLGANGLEGFLPGGR
FPFRGNSGEYGSMMTLGTFSQYATVHQNSIVKIDDDLPLDKAALVGCGVPTGWGSAVNSA
EVRPGDTVVIYGIGGIGTNAVQGAAYAGAQHLIAVDPAPDRRESAKRFGATHTAATADEA
LELVTQLTRGVGADSTIITVDELTAEVVSQATEATSKGGTIVITSMGQYEGETIKLSGVQ
LALWGKRIQGSLYGGCNPLYDIPKLLSLYRTGHVKLDELITSIYTLEQVNEGYDDLMAHK
NIRGIIAHEH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccaaggccgcagtcctctacgaggcgggcaagccgttcgagatcgaggagctc
gagatcgtcaagccgggggccgaggaggtgctcgtccgctacgactactccggcctctgc
cattccgatctccacatggtgaagggccacctgcccttccgggccccgatggtcttcggc
catgagggagccggcgagatcctcgaggccgggtccaacgtcaccggtttccatcccggc
gaccacttcgtcgcttcgttctaccctgtgtgcggccggtgccgctggtgtgcgaccggc
aactcccgactgtgcgacctcggcgcgaacggcctggaaggctttctcccgggtggccgc
ttccccttcaggggcaacagcggcgagtacggctcgatgatgacgctgggcaccttcagt
cagtacgcgaccgtgcaccagaactcgatcgtcaagatcgacgacgacctcccgctggac
aaggcggccctcgtcggctgcggggtgcccaccggctggggttccgcggtcaactcggcc
gaggtccggcccggtgacaccgtggtcatctacggcatcggcggcatcggcaccaacgcg
gtccagggtgcggcctacgccggcgcgcagcacctgatcgccgtcgatcccgcgccggac
agacgggagagcgcgaagcgcttcggggcgacgcacaccgccgccacggcggatgaggca
ctcgagctggtcacgcagctcacgcgcggggtcggcgccgacagcaccatcatcacggtc
gacgagctgaccgccgaggtcgtgtcgcaggccaccgaggcgacttccaagggcggaacc
atcgtcatcacgtcgatgggtcagtacgagggcgagacgatcaagctctccggggttcag
ctggcactctggggcaagcggatacagggctccctctacggtgggtgcaaccccctgtac
gacattccgaagctgctttccctctaccgcaccggccacgtcaagctggatgagctcatc
acgagcatctacaccttggagcaggtcaacgagggctacgacgacctgatggcgcacaag
aacatccgcggcatcatcgcgcacgagcactag

DBGET integrated database retrieval system