KEGG   Frankia alni: FRAAL0303Help
Entry
FRAAL0303         CDS       T00384                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fal  Frankia alni
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:fal03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(326455..327201)
Genome map
AA seq 248 aa AA seqDB search
MSVASPQGRFTEGARRLDGRPLTDAEAHGKHLLLRFDHDQVLHVHLGIYGTYAFGPGPAP
VPTGAVRLRLTADTGYADLRGPNACELLEPGGVKTLRDRLGPDPLRGDADPDLAWRRIER
SRTPIAVLLLDQMVVAGPGNIYRAEVLFRAGVDPLLPGRDLTRRQWTAIWADLVTLMADG
VRTGRIDTVRPEHTPEAMGRPPRVDDHGGEVYVYRRAGQPCLICATTVLTNRLAARNLFW
CPGCQRPS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtggccagcccccaggggcggttcaccgagggcgcgcgccggctggacgggcgg
ccgctcaccgacgccgaggcgcacggcaagcatctgctcctgcggttcgaccacgaccag
gtcctgcatgtgcacctcggcatctacggcacctacgcctttggccccgggcccgctccc
gtgccgaccggcgccgtccggctgcggctcaccgcggacaccggctacgccgacctgcgc
ggtcccaacgcctgcgagctgctggaacccggtggagtgaagacgctgcgcgaccggctc
ggccccgatccgctgcgcggcgatgccgacccggacctggcctggcgccggatcgagcgc
agccgcaccccgatcgccgtcctcctgctcgaccagatggtcgtggccggcccgggcaac
atctaccgggccgaggtgctgttccgggccggtgtcgacccgctgctacccggacgggac
ctgacccggcggcagtggacggccatctgggccgacctggtcacgctgatggccgacggg
gtgcgcacgggccggatcgacaccgtgcgccccgagcacacccccgaggcgatgggccgt
ccgcccagggtcgacgaccacggtggcgaggtctacgtctaccgccgcgccggccagccc
tgcctgatctgcgccaccacggtgctgaccaaccgcctggccgcccgcaacctgttctgg
tgccccggctgccagcgaccgtcctga

DBGET integrated database retrieval system