KEGG   Frankia alni: FRAAL0531Help
Entry
FRAAL0531         CDS       T00384                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
fal  Frankia alni
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    FRAAL0531
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    FRAAL0531
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     FRAAL0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(590777..591787)
Genome map
AA seq 336 aa AA seqDB search
MAAIRRDILRDDKARADYIRGVKLLKHEPTTLTTDRFGIPDRARPVYTYDLFVIWHVLAM
NTAVPPGGDAGTRNAAHRGPVFLPWHRVMLRWLEAHLQRVLGDPDFGLPYWDWALDGTPP
APGGVANPAASVLWRDTPDGFGGQGSPVRGGAFAFDRADPTSFRVRIATGSSGALRQVTE
RGLARSFGQNAPFGSPRLPRTGDVRAAYDTRADPSLADYDRPPFDVSSRGFRNRLEGFTG
PGLHNQVHLWVGGDMAPASSPNDPVFFVHHCNVDRLWEGWMSRNGRRYQPDMTAPPTLLG
HRIDDPLVSPFTPASKPDTPGGVLDVSAIYTYDVLP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgatccgccgggacatcctccgcgacgacaaggcgcgtgcggactacatccgc
ggcgtcaagctgctcaagcacgagcccaccacgctgaccacggaccggttcggcatcccc
gatcgtgcccgccccgtgtacacctacgacctgttcgtcatctggcatgtcctcgccatg
aacaccgcggtgcctccgggcggtgacgccgggacccgcaacgccgcgcaccgcgggccg
gtgttcctgccctggcaccgggtgatgctccggtggttggaggcacacctgcaacgggtt
ctcggtgacccggacttcggcctgccctactgggactgggcgctcgacggcaccccgccc
gcgccgggcggcgtggcgaacccggccgcctcggtgctgtggcgggacaccccggacggg
ttcggcggtcagggcagccccgtgcgcggtggggcgttcgccttcgaccgggccgacccg
acgagtttccgggtccggatcgcgaccggttccagcggcgcgctgcgccaggtcaccgag
cgcggcctcgcccgcagtttcggccagaacgccccgttcggctcgccgcggctgcctcgc
accggcgacgtccgcgcggcctacgacacgcgtgccgacccgagcctcgccgactacgac
cggccgccgttcgacgtctcctcccgcggcttccgcaaccggctggagggcttcaccggc
cccggcctgcacaaccaggtccacctgtgggtcggcggcgacatggccccggcgtcgtcc
cccaacgacccggtgttcttcgtccaccactgcaacgtcgaccggctctgggagggctgg
atgagccgcaacggccgccggtaccagccggacatgacggccccgccgaccctgctcggc
caccggatcgacgacccgctcgtctccccgttcaccccggccagcaagccggacaccccg
ggcggcgtcctcgacgtctcggccatctacacctacgacgtcctgccctga

DBGET integrated database retrieval system