KEGG   Frankia alni: FRAAL0607Help
Entry
FRAAL0607         CDS       T00384                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    FRAAL0607
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL0607
  Lipid metabolism
   00071 Fatty acid degradation
    FRAAL0607
  Amino acid metabolism
   00350 Tyrosine metabolism
    FRAAL0607
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FRAAL0607
   00626 Naphthalene degradation
    FRAAL0607
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FRAAL0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
667023..668045
Genome map
AA seq 340 aa AA seqDB search
MRAWQVVAPGPMGTRPLRAAELPVPEPGPGQVRLRVDACGVCRTDLHLAEGDLVPHRPRT
VPGHEVVGRVDALGPGVPAAVDAGPPGVRLGDRLGVAWLASTDGTCAYCARGAENLCPAS
TYTGWDVDGGYAEYVCVRADYAYRLPAGYSDAELAPLLCAGIVGYRALRRAALPPGGRLG
IYGFGASAHLAAQVAIAQGARVHVLTRSARAQALALELGAASAAGAYDAPPEPLDAAVLF
APVGELVPVALAALDRGGTLSVAGIHLSDIPPLVYADHLFQERDLRSTTANTRADGAEFL
AIAAEHRLAVTVSPYPLDAADQALDDLAADRVTGAAVLLP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcctggcaggtcgtcgcgccggggccgatgggcacgcgcccgctgcgcgcggcc
gagctgcccgtgcccgaaccggggcccgggcaggtccggctgcgcgtcgacgcgtgcggc
gtgtgccgcaccgacctgcacctcgccgagggcgacctcgtgccgcaccggccgcgcacc
gtgccggggcacgaggtcgtcggccgggtcgacgcgctcggccccggggtgccggcggcg
gtggacgcaggtccgccgggggtgcgcctgggcgaccggctgggcgtggcgtggctcgcc
tcgaccgacgggacctgcgcctactgtgcccgcggcgcggagaatctctgccccgcgtcg
acctacaccggctgggacgtcgacggcgggtacgccgagtacgtctgcgtccgcgccgac
tacgcctaccggctgcccgccggctacagcgacgccgagctcgccccgctgttgtgcgcc
ggcatcgtcggctaccgggcgctgcggcgggcggcactgccccccggcggccggctgggt
atctacggcttcggcgcgtccgcgcatctcgccgcccaggtggcgatcgcccagggggcg
cgggtccatgtgctgacccgctcggcccgcgcgcaggccctggccctcgaactcggcgcg
gcgtccgcggccggggcgtacgacgcgccgcccgagccgctggacgcggcggtgctgttc
gcgccggtgggcgagctggtgccggtggcgctcgcggcgctcgaccgcggcggcaccctg
tcggtggcgggcatccacctcagcgacatcccgccactcgtctatgccgaccacctgttt
caggagcgcgacctgcgcagcacgaccgcgaacacccgggccgacggcgcggagttcctc
gcgatcgccgccgagcaccggctggcggtgacggtgtcgccctacccgctcgacgccgcc
gaccaggccctcgacgatctcgccgccgaccgggtcaccggcgcggccgtcctgctgccc
tga

DBGET integrated database retrieval system