KEGG   Frankia alni: FRAAL0770Help
Entry
FRAAL0770         CDS       T00384                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fal  Frankia alni
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FRAAL0770
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FRAAL0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(834912..835985)
Genome map
AA seq 357 aa AA seqDB search
MGRVVVVGWTSMDVTTRVARIPRPGETVTGSAVTLSPGGRGANQAVAARRLGAETVMVGA
VGSDGFGSALREFLRGEAVDVTPLAVVDGPSGTAVTTVDEAGESVIVIVPGANAAVSAGG
LDALRLGPGDVVLLQNEIPAAVNATALTRARAAGARTVLNAAPRGPVALNAVPRQPAAAD
PFTAAGPFTEADPFTQAGRFTQADPFTDAGRFTEADLLAAADVILLDEHEFAGLVPAAVG
VGSLPGPQALVEVRGLLADGAGPNDNIVVTLGGAGVCARIAGTVVTLAARRVPVVDTAGA
DDCFCGAFGAGLAGGLPAATALFHANLAATIAVQRPGAGPAMPTRAELDDLLTGGGP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgggacgggtcgtggtggtcggctggaccagcatggacgtgacgacccgcgtggcccgc
atcccccgaccgggcgagacggtgacggggagcgccgtgacgctgtcccccggcggcagg
ggcgcgaaccaggcggtggcggcacggcggctgggcgccgagacggtcatggtgggcgcc
gtcggctccgacggtttcggctcggcactgcgggagttcctgcgcggcgaggcggtcgac
gtcaccccgctggcggtcgtcgacggacccagcgggacggccgtgacgacggtcgacgag
gccggcgagagcgtgatcgtcatcgtgccgggcgccaacgccgccgtgtcggcgggcggc
ctggatgcgctgcggctgggcccgggtgacgtggtgctgctgcagaacgagatcccggcg
gcggtgaacgcgaccgcgctcacccgcgcccgcgccgcgggcgcccgcacggtgctcaac
gcggccccgcgcgggcccgtcgcgctgaacgcggtcccgcgccagcccgccgcggccgac
ccgttcaccgcggccggccccttcaccgaagccgacccgttcacccaagccggccggttc
acccaggccgacccgttcaccgatgccggccggttcaccgaagccgacctgctcgctgcc
gccgacgtgatcctgctcgacgagcacgagttcgcgggcctggtcccggctgccgtcggt
gtcggctcgctgcccggcccgcaggccctcgtcgaggtgcgcggcctgctcgccgacggc
gccgggccgaacgacaacatcgtcgtcaccctcggcggcgccggggtgtgcgcgcggatc
gccgggacggtcgtcaccctcgccgcgcggcgcgtcccggtcgtcgacacggccggagcc
gacgactgcttctgcggagcgttcggcgccggcctcgccggcggtctgcccgcggccacg
gccctgttccacgcgaacctcgccgccaccatcgccgtgcagcgtccgggcgccggaccc
gcgatgccgacgcgcgcggagctcgacgacctgttgaccggcggcggcccataa

DBGET integrated database retrieval system