KEGG   Frankia alni: FRAAL0799Help
Entry
FRAAL0799         CDS       T00384                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fal  Frankia alni
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    FRAAL0799
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FRAAL0799
Enzymes [BR:fal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     FRAAL0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
872523..873776
Genome map
AA seq 417 aa AA seqDB search
MRLAVDPAARGQRIDGFGAALTESSARLLWGLPPDQRAAVLRSLFDPVAGAGLSVVRVPM
GASDFATGQYTYDDVAAGTADPRLARFSVARDDRVVVPVLREILAVDSRVRIVASPWSAP
AWMKSSSRLGGGSLRPRWYRAWAEYFVRFVRAYAARGITVSAVTVQNEPGHGDPSYPTMT
MSAAEQARFVATALGPAFAAAGLTTDIVGYDHNWDTPAVPTQVLGDAAAGRYLSGIGWHC
YRGDPSAQSQVHADFPGKATWLTECSAGDWHGRPADGFGWLADVVVDALRNWASTALLWN
LALDPAGGPHLGGCGGCRGVVTIAPRAGTDLREVDRSPEFDLLGLAARAAPRGAVRIGAR
ASSGAVGAVAFSLPDGHRSVLAHNRTDDEAVLTVDDGGGAFTVRLAPHALAAFRWRR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctggccgtcgatcccgccgcccgggggcagcgcatcgacggcttcggtgccgca
ctgaccgagtcctcggcgcggctgctgtgggggctaccccccgaccagcgggccgcggtg
ctgcgcagcctgttcgacccggtcgcgggtgccggcctgagtgtggtgcgggtgccgatg
ggcgccagcgacttcgccaccggccagtacacctacgacgacgtggccgccggcaccgcc
gacccgcgcctggcccggttctcggtcgcccgcgacgaccgggtcgtggtgcccgtgctg
cgggagattctcgcggtcgacagccgggtccgcatcgtggcgagcccctggagcgcaccc
gcctggatgaagtcctctagtcggctcggcggcggttcgctgcggccgcgctggtacaga
gcctgggccgagtacttcgtgcggttcgtccgggcctacgccgcccgcgggatcacggtg
tccgcggtgacggtccagaacgagcccggccacggcgacccgtcctacccgacgatgacc
atgtccgcggccgagcaggcgcggttcgtggccaccgcgctcgggccggcgttcgccgcc
gccgggctgaccaccgacatcgtcggctacgaccacaactgggacaccccggccgtcccg
acgcaggtgctcggcgacgccgcggccgggcgttacctcagcggcatcggctggcactgc
tatcggggtgacccgtccgcgcagtcccaggtgcacgcggattttcccgggaaggcgacc
tggctgacggagtgttccgcgggggactggcacggccgcccggcggacgggttcggctgg
ttggcggacgtcgtggtggacgcgctgcgcaactgggcgtcgacggccctgctgtggaat
ctcgcgctggatcccgcgggcggcccgcacctggggggctgcggcggctgccgcggggtg
gtcacgatcgcgccccgggcggggacggacctgcgcgaggtcgatcggtcgccggagttc
gacctgctcggtctcgcggcccgggcggcgccgcgcggggcggtgcggatcggcgcgcgg
gcatcctccggggcggtcggtgcggtcgccttcagcctgcccgacggccaccggtcggtg
ctggcgcacaaccggaccgacgacgaggccgtgctgacggtggacgacggcggcggcgcg
ttcacggtgcggctggccccgcacgcgcttgccgcgttccgctggcggcgctga

DBGET integrated database retrieval system