KEGG   Frankia alni: FRAAL0964Help
Entry
FRAAL0964         CDS       T00384                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fal  Frankia alni
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL0964 (gpmA)
   01230 Biosynthesis of amino acids
    FRAAL0964 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL0964 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    FRAAL0964 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FRAAL0964 (gpmA)
Enzymes [BR:fal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FRAAL0964 (gpmA)
Exosome [BR:fal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FRAAL0964 (gpmA)
  Exosomal proteins of melanoma cells
   FRAAL0964 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1029089..1029823
Genome map
AA seq 244 aa AA seqDB search
MTTLVLLRHGESNWNRENLFTGWVDVDLSEKGLKEATRGGELLAEAGVLPDVVHTSLLTR
AIRTAWLALDAAGRTWVPVRRSWRLNERHYGGLQGLNKAETLEKFGEEQFQLWRRSYDTP
PPEIGPEQVSGVDERYADLAPDLIPRTECLADVVARMLPYWYDAIVPDLRAGRTVLVAAH
GNSLRALVKHLDHISDTDIAGLNIPTGIPLRYELDDDLGVLSSGYLDPDAAASAAAAVAA
QGKK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctcgtcctgctccgccacggtgagagcaactggaaccgcgagaacctgttc
accggctgggtggacgtcgacctgtccgagaagggcctgaaggaggccacccgcggcggt
gagctgctggccgaggccggtgtcctgcccgacgtggtgcacacgtccctgctgaccagg
gcgatccgcaccgcctggctggcgctggacgccgccgggcggacctgggtaccggtccgc
cggagctggcggctgaacgaacggcactacggcggcctgcagggtctgaacaaggccgag
acgctggagaagttcggcgaggagcagttccagctctggcggcgctcctacgacacgccg
ccgccggagatcggtccggagcaggtcagcggggtggacgagcgctacgccgatctcgcc
cccgacctcatcccgcgcaccgagtgcctcgccgacgtcgtcgcccgcatgctgccctac
tggtacgacgcgatcgtgccggacctgcgggccggccgcacggtcctggtggccgcgcac
ggcaactcgctgcgagccctggtcaagcacctcgaccacatcagcgacaccgacatcgcc
gggctcaacatcccgaccggcatcccgctgcggtacgagctcgacgacgacctgggcgtg
ctgagctcgggatatctcgacccggatgcggccgcgagtgctgcggccgccgtcgccgcc
caggggaagaagtaa

DBGET integrated database retrieval system