KEGG   Frankia alni: FRAAL1020Help
Entry
FRAAL1020         CDS       T00384                                 

Gene name
corA
Definition
uroporphyrin-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
fal  Frankia alni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FRAAL1020 (corA)
Enzymes [BR:fal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     FRAAL1020 (corA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FRAAL1020 (corA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1089576..1091141
Genome map
AA seq 521 aa AA seqDB search
MHAVTDGQIAGEVWLVGAGPGDPGLLTVRGRELLATADVVVVDRLAAAVLLDAAPPDAEI
IHVGKSPTARSWAQEKINAVLVDRARAGARVVRLKGGDPYVLGRGGEEAQACAEAGVACT
VVPGITSALAVPALAGIPVTHRDLAQELAVVSGHLPPGHPDSTVDWAGLAASRATIVILM
GVARLMDIADALLAGGRPEVTPVAVIERGATPAQRVLRTTLDALAIDAIAAGVRSPAVIV
VGEVAARNDAPAVGAAPLAGVRVLVARTRPRPGLLARRLRQLGADAVETVVAHPAPPDDA
GAALLAALPGAAGLVLADPDEVAAVVALLRRAGTDVRALAGLTLVAARPDVTDALDALGL
AATTLDQLGQADRTDAGAGDAGRVARAAGAGPAAAGRRPAPGPAVLVVGAADLPAGGPWT
PRRVPLLTDVTADPDPRIADELRHGDFDVAAFASSTAARSTAQLYGPLPPDLLVAAMGRR
SAEACEAAGIRVDIVPTEPGVRPLAAAVADFVTASRAAAAS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgccgtgacggacgggcaaatcgcgggtgaggtctggctggtcggggctgggccg
ggtgatcccgggctgttgaccgtgcgtggtcgtgagctgcttgcgaccgccgacgtggtc
gtggtcgaccggctcgccgcggccgtcctgctcgacgccgcgccgcccgacgcggagatc
attcacgtcggcaagagcccgaccgcccgctcctgggcccaggagaagatcaacgcggtc
ctcgtcgaccgggcccgggccggcgcccgggtcgtgcggctcaagggcggcgatccctac
gtcctgggccggggcggggaggaggcccaggcctgcgccgaggctggcgtggcctgcacc
gtcgtccccggcatcacctcggcgctggccgtgccggcgctggccggcattccggtcacc
caccgcgacctggcgcaggaacttgccgtcgtctccggtcacctgccgcccggccacccc
gactcgaccgtcgactgggcgggactggccgcctcccgggcgacgatcgtcatcctcatg
ggggtggcgcggctgatggacatcgccgatgccctgctcgccggcggccgcccggaggtc
accccggtcgcggtgatcgagcggggcgccaccccggcccagcgggtcctgcgcaccacg
ctcgacgccctggccatcgacgcgattgccgcgggtgtgcgctcaccggcggtgatcgtg
gtcggcgaggtcgccgcccgcaacgacgccccggccgtcggtgcggcgccgctcgccggc
gtgcgcgtcctggtcgcccgcacccggcctcgccccggcctgctggcccgccggctgcgg
cagctcggcgcggacgcggtcgagaccgtcgtggcccatcccgccccgcccgacgacgcc
ggcgcggcgttgctggcggcgctgcccggggccgcgggcctcgtgctcgccgacccggac
gaggtcgccgcggtggtcgccctgctgcgccgggcgggcaccgacgtgcgcgcactggcc
gggctgaccctggtggccgcccgccccgacgtcaccgacgccctcgacgcgctgggcctg
gccgccaccacactcgaccagctcggccaggccgaccggaccgacgcgggcgcgggcgac
gccggccgggtcgcccgtgcggcgggtgccgggccggcagcggcgggccgccggccggcc
ccggggccggcggtgctcgtcgtcggcgcggccgatctgccggcgggcggcccctggact
ccgcgccgcgtgccgctgttgaccgacgtgaccgccgatcccgatccgcggatcgccgac
gagctgcggcacggcgacttcgacgtcgcggccttcgcctcctcgacggctgcccgcagt
accgcccagctgtacgggccgctgcccccggacctgctcgtcgccgcgatgggccggcgt
agcgccgaggcctgcgaggccgccggcatccgggtggacatcgtgccgaccgagccgggg
gtgcgcccgctcgccgccgccgtcgccgacttcgtcaccgccagccgcgccgccgcggcc
tcctga

DBGET integrated database retrieval system