KEGG   Frankia alni: FRAAL1075Help
Entry
FRAAL1075         CDS       T00384                                 

Gene name
mug
Definition
DNA glycosylase, G/U mismatch-specific
Orthology
K03649  
TDG/mug DNA glycosylase family protein [EC:3.2.2.-]
Organism
fal  Frankia alni
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:fal00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    FRAAL1075 (mug)
Enzymes [BR:fal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     FRAAL1075 (mug)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1153764..1154354)
Genome map
AA seq 196 aa AA seqDB search
MFDAVGSQPPAAPPARPTRAELLAAYDTEVPDLLAPRTTVLLCGINPSLESGATGFHFGT
PSNRLWPVLHLAGFTPRRLHPSETAELTSRGISITNLVNRSTARADEIGDDEVRAGVDRL
TGLVERISPHWVAFLGLAAYRVGFGRRRAQVGRQPETLGQAGVWLLPNPSGLNAHYQLPD
LVRVYGELREAAYPDR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacgcagttggctcgcagccgccggccgccccacccgcccggccgacccgggcc
gagctgctcgccgcctacgacaccgaggttcccgacctcctcgccccgcggaccaccgtg
ctgctgtgcgggatcaacccgtccctggagtccggggcgaccggcttccacttcggcacg
ccgagcaaccgcctgtggcccgtcctgcacctcgccgggttcaccccacgccggctgcac
cccagcgagaccgccgagctgaccagccgcggcatcagcatcaccaacctggtcaaccgg
tccaccgcccgcgccgacgagatcggcgacgacgaggtccgggccggcgtcgaccggctc
accgggctcgtcgagcggatctcgccgcactgggtggccttcctcggcctggccgcctac
cgggtcggcttcggccggcgccgggcgcaggtcggtcgccagccggagaccctgggtcag
gcgggcgtctggctgctgcccaacccgagcggtctgaacgcccactaccagctacccgac
ctggtccgggtgtacggcgagctccgcgaggcggcgtaccccgaccgatga

DBGET integrated database retrieval system