KEGG   Frankia alni: FRAAL1189Help
Entry
FRAAL1189         CDS       T00384                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fal  Frankia alni
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FRAAL1189 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FRAAL1189 (sdhD)
   00650 Butanoate metabolism
    FRAAL1189 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    FRAAL1189 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1262553..1262984)
Genome map
AA seq 143 aa AA seqDB search
MPADRGAPELAAPRSPRRRTKPGAAKARSNFELYAWVFMRISGLLLFFLVLGHLFIMNVL
DGGVQRVNFGFVAGRWASPFWRTWDLVMLLLAELHGTNGLRTVINDYAERAQTRFWLKML
LYTSAFLVVTLGTLVIFTFDPTL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggaccggggcgcgccggagctggccgccccgcgctcgccgcggcggcggacg
aagccgggcgccgcgaaggcccgcagcaacttcgagctctacgcctgggtgttcatgcgg
atcagcggcctgctgctgttcttcctggtgctcggccacctgttcatcatgaacgtgctc
gacggcggcgtgcagcgggtgaacttcggtttcgtcgcgggccgctgggcatcgccgttc
tggcgcacgtgggacctggtgatgctgctgctggccgagctgcacggcaccaacgggctg
cgcaccgtgatcaacgactacgcggaacgggcacagacccggttctggctgaagatgctg
ctctacacctcggcgtttctggtcgtcaccctcggcacgctggtcatcttcaccttcgac
cccactctgtga

DBGET integrated database retrieval system