KEGG   Frankia alni: FRAAL1189Help
Entry
FRAAL1189         CDS       T00384                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
fal  Frankia alni
Pathway
fal00020  Citrate cycle (TCA cycle)
fal00190  Oxidative phosphorylation
fal00650  Butanoate metabolism
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01200  Carbon metabolism
Module
fal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fal_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FRAAL1189 (sdhD)
   00650 Butanoate metabolism
    FRAAL1189 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    FRAAL1189 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF2768 CybS
Motif
Other DBs
NCBI-ProteinID: CAJ59851
RhizoBase: FRAAL1189
UniProt: Q0RRG8
Position
complement(1262553..1262984)
Genome map
AA seq 143 aa AA seqDB search
MPADRGAPELAAPRSPRRRTKPGAAKARSNFELYAWVFMRISGLLLFFLVLGHLFIMNVL
DGGVQRVNFGFVAGRWASPFWRTWDLVMLLLAELHGTNGLRTVINDYAERAQTRFWLKML
LYTSAFLVVTLGTLVIFTFDPTL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggaccggggcgcgccggagctggccgccccgcgctcgccgcggcggcggacg
aagccgggcgccgcgaaggcccgcagcaacttcgagctctacgcctgggtgttcatgcgg
atcagcggcctgctgctgttcttcctggtgctcggccacctgttcatcatgaacgtgctc
gacggcggcgtgcagcgggtgaacttcggtttcgtcgcgggccgctgggcatcgccgttc
tggcgcacgtgggacctggtgatgctgctgctggccgagctgcacggcaccaacgggctg
cgcaccgtgatcaacgactacgcggaacgggcacagacccggttctggctgaagatgctg
ctctacacctcggcgtttctggtcgtcaccctcggcacgctggtcatcttcaccttcgac
cccactctgtga

DBGET integrated database retrieval system